Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J139

Protein Details
Accession A0A397J139    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
204-229STTDTLPKKYKNRIRIKNHTNNGFRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MDSTLTGNQCLNIPMGGKYSIIKLWEDLKQGNLNKKGLRDNGIMFVEQIMDLELTNILDWQHILTMRPKRGRPPKWYTQIIQNKDLFLKTIREKLENLYEHNINVFTNLQKKNISSKNIWIAQREGKELIIGKEIKKKINDKNNEDSRMKHFNVLGKNLEPTSVLIPCEGCDLNMEENNNSCIYRLDNNKIDKIEIPVSYSTVSTTDTLPKKYKNRIRIKNHXTNNGFRVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.16
4 0.15
5 0.15
6 0.17
7 0.17
8 0.18
9 0.17
10 0.17
11 0.2
12 0.24
13 0.27
14 0.25
15 0.27
16 0.33
17 0.38
18 0.45
19 0.46
20 0.47
21 0.46
22 0.49
23 0.52
24 0.49
25 0.49
26 0.44
27 0.4
28 0.41
29 0.39
30 0.35
31 0.28
32 0.24
33 0.19
34 0.15
35 0.12
36 0.07
37 0.06
38 0.05
39 0.06
40 0.06
41 0.05
42 0.05
43 0.06
44 0.05
45 0.05
46 0.06
47 0.05
48 0.07
49 0.07
50 0.09
51 0.16
52 0.23
53 0.31
54 0.37
55 0.39
56 0.48
57 0.58
58 0.65
59 0.67
60 0.68
61 0.71
62 0.73
63 0.76
64 0.67
65 0.67
66 0.68
67 0.63
68 0.61
69 0.52
70 0.44
71 0.41
72 0.39
73 0.29
74 0.22
75 0.23
76 0.19
77 0.24
78 0.24
79 0.25
80 0.26
81 0.27
82 0.33
83 0.29
84 0.29
85 0.27
86 0.26
87 0.24
88 0.24
89 0.21
90 0.13
91 0.12
92 0.11
93 0.09
94 0.16
95 0.17
96 0.18
97 0.19
98 0.2
99 0.27
100 0.31
101 0.34
102 0.28
103 0.31
104 0.35
105 0.4
106 0.4
107 0.34
108 0.32
109 0.32
110 0.32
111 0.29
112 0.23
113 0.18
114 0.18
115 0.18
116 0.15
117 0.16
118 0.16
119 0.16
120 0.24
121 0.26
122 0.29
123 0.32
124 0.38
125 0.42
126 0.51
127 0.58
128 0.56
129 0.64
130 0.68
131 0.7
132 0.64
133 0.58
134 0.54
135 0.53
136 0.47
137 0.39
138 0.34
139 0.33
140 0.36
141 0.37
142 0.34
143 0.28
144 0.29
145 0.26
146 0.24
147 0.19
148 0.16
149 0.15
150 0.13
151 0.12
152 0.11
153 0.11
154 0.11
155 0.13
156 0.12
157 0.1
158 0.1
159 0.12
160 0.14
161 0.16
162 0.17
163 0.15
164 0.17
165 0.18
166 0.18
167 0.15
168 0.13
169 0.12
170 0.13
171 0.19
172 0.25
173 0.3
174 0.37
175 0.41
176 0.45
177 0.45
178 0.44
179 0.39
180 0.38
181 0.35
182 0.28
183 0.27
184 0.23
185 0.24
186 0.23
187 0.21
188 0.17
189 0.13
190 0.14
191 0.12
192 0.13
193 0.21
194 0.24
195 0.3
196 0.35
197 0.42
198 0.49
199 0.59
200 0.66
201 0.68
202 0.75
203 0.8
204 0.85
205 0.88
206 0.9
207 0.91
208 0.91
209 0.9
210 0.85