Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IXQ6

Protein Details
Accession A0A397IXQ6    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-22SNPYQTRTKGAPKKRLKNALEHydrophilic
52-78VGHNARSCELKKRKKKDKCQITLVTFTHydrophilic
NLS Segment(s)
PositionSequence
62-67KKRKKK
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MSNPYQTRTKGAPKKRLKNALEDVTKNQHTQNNKQDGFTIQTKYICSYCKGVGHNARSCELKKRKKKDKCQITLVTFTLKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.88
4 0.79
5 0.78
6 0.77
7 0.75
8 0.7
9 0.63
10 0.57
11 0.54
12 0.53
13 0.45
14 0.4
15 0.35
16 0.34
17 0.4
18 0.45
19 0.48
20 0.47
21 0.46
22 0.44
23 0.41
24 0.4
25 0.34
26 0.27
27 0.18
28 0.19
29 0.19
30 0.2
31 0.2
32 0.17
33 0.15
34 0.16
35 0.17
36 0.2
37 0.21
38 0.27
39 0.33
40 0.38
41 0.41
42 0.4
43 0.4
44 0.39
45 0.4
46 0.43
47 0.46
48 0.5
49 0.56
50 0.65
51 0.74
52 0.81
53 0.91
54 0.92
55 0.93
56 0.91
57 0.9
58 0.89
59 0.83
60 0.79
61 0.69