Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IHK3

Protein Details
Accession A0A397IHK3    Localization Confidence High Confidence Score 20.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-36KSYSSNFAAKRKKFKMKFRSKKDQQQSIAILHydrophilic
144-173THDSIHGKVHKRKRYKLRRVMLRIHKKICCBasic
315-344THDSIHGKVHKRKRYKLRRVMLRIHKKICCBasic
NLS Segment(s)
PositionSequence
15-27KRKKFKMKFRSKK
151-164KVHKRKRYKLRRVM
205-214RRGKRRIRSK
323-336KVHKRKRYKLRRVM
377-386RRGKRRIRSK
Subcellular Location(s) nucl 15, mito_nucl 13.833, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR010095  Transposase_IS605_OrfB_C  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006310  P:DNA recombination  
GO:0032196  P:transposition  
Pfam View protein in Pfam  
PF07282  OrfB_Zn_ribbon  
Amino Acid Sequences MNDLLKSYSSNFAAKRKKFKMKFRSKKDQQQSIAILSKHWGKSKGVYTFLCKMKSAENLPAELHYDSRLVMNRLGEFYLYIPQPLEIWAENQGPTQSDAVIALDPGVRTFITGYDPSGQAVEWGKNDISRIYRLSHIYDKIQSTHDSIHGKVHKRKRYKLRRVMLRIHKKICCLINDCHHKLAKWLCQSYRIILLPKFQTQGMVRRGKRRIRSKTARMMLTWSHFRFRQYLLHKVREYPWCRVIICTEEYTXIPQPLEIWAENQGPTQSDAVIALDPGVRTFITGYDPSGQAVEWGKNDISRIYRLSHIYDKIQSTHDSIHGKVHKRKRYKLRRVMLRIHKKICCLINDCHHKLAKWLCQSYRIILLPKFQTQGMVRRGKRRIRSKTARMMLTWSHFRFRQYLLHKVREYPWCRVIICTEEYTNKTCGCCGHIHRKLGGSKVFRCPSCTAELDRDINGARNILLRYLTVISKEPVYAGAGTYPWDLHDPCRTRIFPYWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.63
3 0.67
4 0.76
5 0.79
6 0.86
7 0.87
8 0.89
9 0.92
10 0.91
11 0.93
12 0.92
13 0.94
14 0.93
15 0.92
16 0.85
17 0.83
18 0.76
19 0.71
20 0.67
21 0.57
22 0.47
23 0.4
24 0.44
25 0.39
26 0.4
27 0.37
28 0.34
29 0.41
30 0.48
31 0.51
32 0.49
33 0.48
34 0.49
35 0.54
36 0.57
37 0.52
38 0.45
39 0.4
40 0.39
41 0.43
42 0.41
43 0.41
44 0.37
45 0.37
46 0.36
47 0.36
48 0.34
49 0.27
50 0.24
51 0.17
52 0.15
53 0.13
54 0.17
55 0.19
56 0.19
57 0.21
58 0.23
59 0.23
60 0.24
61 0.24
62 0.2
63 0.17
64 0.16
65 0.19
66 0.16
67 0.15
68 0.14
69 0.14
70 0.14
71 0.14
72 0.15
73 0.1
74 0.11
75 0.15
76 0.17
77 0.17
78 0.18
79 0.18
80 0.17
81 0.18
82 0.17
83 0.12
84 0.11
85 0.11
86 0.1
87 0.1
88 0.08
89 0.07
90 0.08
91 0.08
92 0.08
93 0.08
94 0.07
95 0.07
96 0.08
97 0.08
98 0.11
99 0.11
100 0.13
101 0.16
102 0.16
103 0.16
104 0.16
105 0.15
106 0.13
107 0.16
108 0.16
109 0.13
110 0.16
111 0.16
112 0.16
113 0.17
114 0.18
115 0.18
116 0.18
117 0.2
118 0.2
119 0.23
120 0.25
121 0.29
122 0.31
123 0.31
124 0.32
125 0.34
126 0.34
127 0.32
128 0.32
129 0.29
130 0.26
131 0.25
132 0.27
133 0.25
134 0.24
135 0.29
136 0.34
137 0.4
138 0.47
139 0.54
140 0.58
141 0.64
142 0.73
143 0.77
144 0.81
145 0.85
146 0.86
147 0.87
148 0.88
149 0.87
150 0.88
151 0.88
152 0.87
153 0.84
154 0.81
155 0.73
156 0.65
157 0.62
158 0.56
159 0.5
160 0.44
161 0.4
162 0.42
163 0.49
164 0.49
165 0.49
166 0.46
167 0.41
168 0.41
169 0.43
170 0.41
171 0.39
172 0.41
173 0.37
174 0.41
175 0.42
176 0.39
177 0.37
178 0.32
179 0.28
180 0.25
181 0.29
182 0.26
183 0.27
184 0.27
185 0.21
186 0.23
187 0.22
188 0.28
189 0.32
190 0.38
191 0.39
192 0.47
193 0.55
194 0.58
195 0.65
196 0.68
197 0.69
198 0.71
199 0.78
200 0.78
201 0.8
202 0.79
203 0.71
204 0.61
205 0.55
206 0.47
207 0.41
208 0.39
209 0.3
210 0.27
211 0.26
212 0.27
213 0.26
214 0.26
215 0.3
216 0.27
217 0.36
218 0.39
219 0.45
220 0.45
221 0.45
222 0.48
223 0.49
224 0.48
225 0.43
226 0.4
227 0.36
228 0.35
229 0.34
230 0.3
231 0.24
232 0.22
233 0.18
234 0.15
235 0.13
236 0.14
237 0.15
238 0.14
239 0.11
240 0.09
241 0.08
242 0.08
243 0.09
244 0.09
245 0.09
246 0.12
247 0.14
248 0.15
249 0.16
250 0.17
251 0.16
252 0.18
253 0.17
254 0.12
255 0.11
256 0.11
257 0.1
258 0.1
259 0.08
260 0.07
261 0.08
262 0.08
263 0.08
264 0.08
265 0.07
266 0.07
267 0.08
268 0.08
269 0.11
270 0.11
271 0.13
272 0.16
273 0.16
274 0.16
275 0.16
276 0.15
277 0.13
278 0.16
279 0.16
280 0.13
281 0.16
282 0.16
283 0.16
284 0.17
285 0.18
286 0.18
287 0.18
288 0.2
289 0.2
290 0.23
291 0.25
292 0.29
293 0.31
294 0.31
295 0.32
296 0.34
297 0.34
298 0.32
299 0.32
300 0.29
301 0.26
302 0.25
303 0.27
304 0.25
305 0.24
306 0.29
307 0.34
308 0.4
309 0.47
310 0.54
311 0.58
312 0.64
313 0.73
314 0.77
315 0.81
316 0.85
317 0.86
318 0.87
319 0.88
320 0.87
321 0.88
322 0.88
323 0.87
324 0.84
325 0.81
326 0.73
327 0.65
328 0.62
329 0.56
330 0.5
331 0.44
332 0.4
333 0.42
334 0.49
335 0.49
336 0.49
337 0.46
338 0.41
339 0.41
340 0.43
341 0.41
342 0.39
343 0.41
344 0.37
345 0.41
346 0.42
347 0.39
348 0.37
349 0.32
350 0.28
351 0.25
352 0.29
353 0.26
354 0.27
355 0.27
356 0.21
357 0.23
358 0.22
359 0.28
360 0.32
361 0.38
362 0.39
363 0.47
364 0.55
365 0.58
366 0.65
367 0.68
368 0.69
369 0.71
370 0.78
371 0.78
372 0.8
373 0.79
374 0.71
375 0.61
376 0.55
377 0.47
378 0.41
379 0.39
380 0.3
381 0.27
382 0.26
383 0.27
384 0.26
385 0.26
386 0.3
387 0.27
388 0.36
389 0.39
390 0.45
391 0.45
392 0.45
393 0.48
394 0.49
395 0.48
396 0.43
397 0.4
398 0.36
399 0.35
400 0.34
401 0.3
402 0.24
403 0.22
404 0.21
405 0.2
406 0.23
407 0.26
408 0.28
409 0.3
410 0.29
411 0.28
412 0.26
413 0.25
414 0.24
415 0.28
416 0.33
417 0.41
418 0.46
419 0.5
420 0.51
421 0.57
422 0.57
423 0.56
424 0.56
425 0.52
426 0.51
427 0.57
428 0.61
429 0.55
430 0.56
431 0.52
432 0.49
433 0.47
434 0.45
435 0.39
436 0.39
437 0.44
438 0.41
439 0.39
440 0.37
441 0.32
442 0.33
443 0.29
444 0.23
445 0.18
446 0.2
447 0.2
448 0.19
449 0.19
450 0.15
451 0.17
452 0.19
453 0.2
454 0.18
455 0.2
456 0.2
457 0.21
458 0.21
459 0.18
460 0.16
461 0.17
462 0.15
463 0.13
464 0.13
465 0.12
466 0.14
467 0.15
468 0.13
469 0.13
470 0.17
471 0.17
472 0.2
473 0.29
474 0.33
475 0.36
476 0.45
477 0.44
478 0.46