Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JHS1

Protein Details
Accession A0A397JHS1    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
143-171VANPDISRRKRTPCKVKRKKIILNDTTSSHydrophilic
NLS Segment(s)
PositionSequence
152-153KR
157-161KVKRK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTEDNNNSRDRSKSMYQGTSPAIEIDYDEELANLTQRQLKSHVVNISKAGTANGKDIESILDSGGQCQVITCEKAKELGLEMDSVKPHKRIPRTKGVTLKSHITDRAISGIVKQVSGKKIQISIRQLLKIVKPEIGLEIIDLVANPDISRRKRTPCKVKRKKIILNDTTSSSSSESVSDSESDIEISE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.48
4 0.5
5 0.49
6 0.43
7 0.38
8 0.3
9 0.23
10 0.17
11 0.16
12 0.13
13 0.12
14 0.11
15 0.1
16 0.09
17 0.1
18 0.1
19 0.11
20 0.09
21 0.09
22 0.13
23 0.14
24 0.16
25 0.2
26 0.25
27 0.27
28 0.32
29 0.38
30 0.35
31 0.36
32 0.36
33 0.34
34 0.29
35 0.26
36 0.21
37 0.17
38 0.16
39 0.17
40 0.16
41 0.15
42 0.14
43 0.14
44 0.13
45 0.11
46 0.11
47 0.08
48 0.1
49 0.09
50 0.1
51 0.11
52 0.1
53 0.08
54 0.08
55 0.09
56 0.08
57 0.1
58 0.11
59 0.11
60 0.11
61 0.13
62 0.13
63 0.12
64 0.12
65 0.11
66 0.11
67 0.11
68 0.11
69 0.11
70 0.12
71 0.13
72 0.13
73 0.13
74 0.16
75 0.21
76 0.3
77 0.37
78 0.42
79 0.51
80 0.56
81 0.6
82 0.65
83 0.63
84 0.58
85 0.52
86 0.5
87 0.41
88 0.37
89 0.32
90 0.25
91 0.22
92 0.17
93 0.17
94 0.14
95 0.12
96 0.1
97 0.14
98 0.13
99 0.13
100 0.13
101 0.16
102 0.17
103 0.2
104 0.2
105 0.17
106 0.23
107 0.26
108 0.32
109 0.33
110 0.37
111 0.39
112 0.38
113 0.39
114 0.36
115 0.34
116 0.33
117 0.3
118 0.25
119 0.22
120 0.21
121 0.21
122 0.19
123 0.16
124 0.1
125 0.09
126 0.07
127 0.07
128 0.06
129 0.06
130 0.05
131 0.05
132 0.05
133 0.09
134 0.16
135 0.2
136 0.28
137 0.32
138 0.42
139 0.53
140 0.64
141 0.71
142 0.74
143 0.83
144 0.86
145 0.92
146 0.93
147 0.93
148 0.92
149 0.91
150 0.91
151 0.88
152 0.84
153 0.76
154 0.69
155 0.61
156 0.53
157 0.44
158 0.34
159 0.27
160 0.2
161 0.18
162 0.15
163 0.13
164 0.14
165 0.14
166 0.13
167 0.13
168 0.13