Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JK09

Protein Details
Accession A0A397JK09    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MAKKKKNKYKKKPKPKFKYQHKRQNQVPQKKDCNQKKSBasic
83-109QPQISQMVRKQRKMKNFCKRLHEQLPIHydrophilic
NLS Segment(s)
PositionSequence
3-23KKKKNKYKKKPKPKFKYQHKR
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
Amino Acid Sequences MAKKKKNKYKKKPKPKFKYQHKRQNQVPQKKDCNQKKSENLRINDKTMENQNIALVGKNGIRESLMVLNHLHILVYRYFLCDQPQISQMVRKQRKMKNFCKRLHEQLPIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.96
3 0.96
4 0.96
5 0.96
6 0.95
7 0.95
8 0.94
9 0.93
10 0.9
11 0.9
12 0.89
13 0.88
14 0.86
15 0.84
16 0.83
17 0.81
18 0.83
19 0.81
20 0.79
21 0.75
22 0.75
23 0.76
24 0.77
25 0.79
26 0.77
27 0.7
28 0.71
29 0.67
30 0.61
31 0.54
32 0.45
33 0.37
34 0.34
35 0.33
36 0.24
37 0.21
38 0.18
39 0.16
40 0.16
41 0.13
42 0.09
43 0.07
44 0.08
45 0.08
46 0.08
47 0.07
48 0.07
49 0.07
50 0.09
51 0.11
52 0.1
53 0.11
54 0.11
55 0.11
56 0.12
57 0.12
58 0.09
59 0.06
60 0.08
61 0.07
62 0.1
63 0.09
64 0.12
65 0.13
66 0.14
67 0.17
68 0.18
69 0.19
70 0.19
71 0.21
72 0.21
73 0.21
74 0.26
75 0.28
76 0.36
77 0.43
78 0.48
79 0.55
80 0.6
81 0.7
82 0.74
83 0.81
84 0.81
85 0.83
86 0.83
87 0.82
88 0.83
89 0.82
90 0.81