Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LNY3

Protein Details
Accession E2LNY3   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
82-107TDAFQCGRCKQRKCRYRQAQTRSADEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003618  TFIIS_cen_dom  
IPR036575  TFIIS_cen_dom_sf  
IPR001222  Znf_TFIIS  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
KEGG mpr:MPER_08559  -  
Pfam View protein in Pfam  
PF01096  TFIIS_C  
PF07500  TFIIS_M  
PROSITE View protein in PROSITE  
PS51321  TFIIS_CENTRAL  
PS00466  ZF_TFIIS_1  
PS51133  ZF_TFIIS_2  
CDD cd13749  Zn-ribbon_TFIIS  
Amino Acid Sequences FNSHGGASTEYRARIRSLFVNLKDKNNPGLRESVVSGLIAADKLAKMSSAEMASEERQAADQKIKQENFFASLGAEEQQAETDAFQCGRCKQRKCRYRQAQTRSADEPMTTFVTCTNCGNRWKFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.27
4 0.31
5 0.37
6 0.4
7 0.49
8 0.49
9 0.54
10 0.55
11 0.53
12 0.52
13 0.51
14 0.47
15 0.4
16 0.4
17 0.35
18 0.33
19 0.31
20 0.25
21 0.19
22 0.16
23 0.14
24 0.1
25 0.09
26 0.07
27 0.06
28 0.05
29 0.04
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.08
36 0.07
37 0.07
38 0.08
39 0.1
40 0.1
41 0.11
42 0.1
43 0.08
44 0.09
45 0.1
46 0.1
47 0.12
48 0.14
49 0.18
50 0.25
51 0.26
52 0.26
53 0.26
54 0.26
55 0.25
56 0.23
57 0.17
58 0.11
59 0.1
60 0.1
61 0.09
62 0.08
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.07
72 0.09
73 0.11
74 0.15
75 0.24
76 0.32
77 0.4
78 0.5
79 0.6
80 0.68
81 0.74
82 0.81
83 0.83
84 0.86
85 0.88
86 0.86
87 0.85
88 0.8
89 0.77
90 0.68
91 0.6
92 0.5
93 0.4
94 0.32
95 0.26
96 0.25
97 0.19
98 0.16
99 0.16
100 0.19
101 0.2
102 0.23
103 0.25
104 0.27
105 0.36