Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397I6D2

Protein Details
Accession A0A397I6D2    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
40-79TRLWTRGNEKPPPRKPRNKTARYRAMLKAKRKRLRKFKTPBasic
NLS Segment(s)
PositionSequence
48-79EKPPPRKPRNKTARYRAMLKAKRKRLRKFKTP
Subcellular Location(s) mito 20.5, cyto_mito 11.5, nucl 2, plas 2
Family & Domain DBs
Amino Acid Sequences MLSIVSRLFAFPIQQALPAPSNLIKPYLQKFQVQQVRYVTRLWTRGNEKPPPRKPRNKTARYRAMLKAKRKRLRKFKTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.18
4 0.18
5 0.17
6 0.18
7 0.15
8 0.17
9 0.17
10 0.18
11 0.16
12 0.19
13 0.23
14 0.28
15 0.28
16 0.29
17 0.3
18 0.37
19 0.42
20 0.38
21 0.38
22 0.37
23 0.37
24 0.35
25 0.34
26 0.27
27 0.23
28 0.27
29 0.24
30 0.24
31 0.27
32 0.33
33 0.39
34 0.45
35 0.51
36 0.58
37 0.66
38 0.71
39 0.76
40 0.8
41 0.8
42 0.83
43 0.85
44 0.85
45 0.86
46 0.86
47 0.87
48 0.81
49 0.81
50 0.78
51 0.78
52 0.76
53 0.76
54 0.76
55 0.76
56 0.8
57 0.84
58 0.87
59 0.87