Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WVK4

Protein Details
Accession K1WVK4   
Localization Confidence High
Confidence Score 20.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-28SDSSEKEERRARRKIEKEFQEEEAcidic
36-60QRRAAGKRKAWLERRQRQKEQASSLHydrophilic
226-252GMPSEQTQSPPKKKQKQAQKQAQESDMHydrophilic
NLS Segment(s)
PositionSequence
14-20RRARRKI
36-52QRRAAGKRKAWLERRQR
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
KEGG mbe:MBM_09247  -  
Amino Acid Sequences MDTGTSDSSEKEERRARRKIEKEFQEEEMREIRMLQRRAAGKRKAWLERRQRQKEQASSLPGPHVEVGEDESKGINKRNTGSDAEPGKITLTRAEPAIDPTLSQAATSGLSTPSLYTFPALSLRMLGAANRVTSYKSPYSQGPDANTAYKSPYGKVPDANTPSPGPHQYEIPHATSPSPRPVPRPATFGVGPDQDATDSEPNILSMQQPYGPAAIRQSIPAKRPFGMPSEQTQSPPKKKQKQAQKQAQESDMEAGQSQGSPGTIFGSLFKWRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.62
3 0.67
4 0.7
5 0.78
6 0.81
7 0.83
8 0.84
9 0.83
10 0.78
11 0.75
12 0.73
13 0.64
14 0.57
15 0.5
16 0.41
17 0.33
18 0.31
19 0.32
20 0.32
21 0.33
22 0.31
23 0.34
24 0.4
25 0.48
26 0.56
27 0.57
28 0.53
29 0.59
30 0.65
31 0.68
32 0.69
33 0.71
34 0.73
35 0.75
36 0.81
37 0.84
38 0.83
39 0.83
40 0.84
41 0.82
42 0.78
43 0.75
44 0.71
45 0.64
46 0.57
47 0.5
48 0.41
49 0.35
50 0.28
51 0.21
52 0.14
53 0.12
54 0.13
55 0.12
56 0.12
57 0.11
58 0.11
59 0.13
60 0.15
61 0.2
62 0.19
63 0.2
64 0.23
65 0.27
66 0.3
67 0.31
68 0.31
69 0.33
70 0.33
71 0.31
72 0.28
73 0.25
74 0.22
75 0.19
76 0.18
77 0.13
78 0.13
79 0.13
80 0.13
81 0.14
82 0.14
83 0.15
84 0.17
85 0.14
86 0.12
87 0.12
88 0.13
89 0.12
90 0.11
91 0.09
92 0.07
93 0.07
94 0.07
95 0.07
96 0.06
97 0.06
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.07
106 0.09
107 0.09
108 0.08
109 0.08
110 0.08
111 0.08
112 0.08
113 0.08
114 0.07
115 0.08
116 0.08
117 0.08
118 0.08
119 0.08
120 0.09
121 0.14
122 0.14
123 0.14
124 0.16
125 0.17
126 0.23
127 0.24
128 0.25
129 0.23
130 0.24
131 0.24
132 0.24
133 0.23
134 0.18
135 0.17
136 0.17
137 0.16
138 0.13
139 0.17
140 0.19
141 0.2
142 0.23
143 0.24
144 0.29
145 0.33
146 0.33
147 0.3
148 0.27
149 0.26
150 0.26
151 0.26
152 0.22
153 0.18
154 0.19
155 0.18
156 0.24
157 0.25
158 0.25
159 0.24
160 0.21
161 0.22
162 0.24
163 0.25
164 0.26
165 0.29
166 0.28
167 0.32
168 0.39
169 0.45
170 0.44
171 0.46
172 0.4
173 0.4
174 0.38
175 0.36
176 0.32
177 0.24
178 0.23
179 0.18
180 0.17
181 0.12
182 0.12
183 0.14
184 0.12
185 0.11
186 0.12
187 0.11
188 0.11
189 0.12
190 0.11
191 0.09
192 0.09
193 0.1
194 0.11
195 0.11
196 0.11
197 0.13
198 0.13
199 0.13
200 0.14
201 0.15
202 0.14
203 0.17
204 0.24
205 0.27
206 0.31
207 0.37
208 0.38
209 0.36
210 0.39
211 0.38
212 0.36
213 0.37
214 0.34
215 0.34
216 0.37
217 0.37
218 0.37
219 0.43
220 0.49
221 0.52
222 0.6
223 0.65
224 0.69
225 0.78
226 0.84
227 0.87
228 0.88
229 0.9
230 0.91
231 0.9
232 0.89
233 0.85
234 0.79
235 0.69
236 0.59
237 0.51
238 0.41
239 0.31
240 0.22
241 0.17
242 0.14
243 0.12
244 0.11
245 0.08
246 0.08
247 0.07
248 0.08
249 0.09
250 0.09
251 0.09
252 0.11
253 0.13