Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397INV4

Protein Details
Accession A0A397INV4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-29ESEVPQKKIFIKRTKNVQERINHydrophilic
NLS Segment(s)
PositionSequence
111-120KKRKEGKGKG
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MKQQISEESEVPQKKIFIKRTKNVQERINKEKRRVVDKATEILQPLFSSRQNKMTFDIPPPISEVHIKKRINEERRKTVEKANEILRPLFNSRQNKVTFDMPPPISEVLIKKRKEGKGKGVYENEKIKELKEKVLKKVDEILRVTSDGSDGGDGSGGGKDLTNFNSSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.43
3 0.49
4 0.51
5 0.59
6 0.65
7 0.74
8 0.82
9 0.83
10 0.81
11 0.8
12 0.79
13 0.77
14 0.79
15 0.79
16 0.74
17 0.72
18 0.71
19 0.69
20 0.67
21 0.64
22 0.59
23 0.58
24 0.56
25 0.53
26 0.49
27 0.44
28 0.38
29 0.34
30 0.28
31 0.19
32 0.17
33 0.16
34 0.17
35 0.2
36 0.2
37 0.28
38 0.29
39 0.31
40 0.31
41 0.32
42 0.31
43 0.3
44 0.35
45 0.27
46 0.25
47 0.25
48 0.23
49 0.21
50 0.24
51 0.24
52 0.25
53 0.34
54 0.34
55 0.34
56 0.44
57 0.52
58 0.57
59 0.63
60 0.62
61 0.63
62 0.7
63 0.72
64 0.64
65 0.61
66 0.57
67 0.51
68 0.47
69 0.41
70 0.37
71 0.33
72 0.32
73 0.26
74 0.22
75 0.22
76 0.23
77 0.26
78 0.28
79 0.29
80 0.35
81 0.36
82 0.35
83 0.35
84 0.34
85 0.3
86 0.27
87 0.32
88 0.25
89 0.25
90 0.25
91 0.23
92 0.19
93 0.18
94 0.19
95 0.22
96 0.3
97 0.3
98 0.33
99 0.41
100 0.48
101 0.55
102 0.58
103 0.59
104 0.62
105 0.67
106 0.69
107 0.68
108 0.66
109 0.63
110 0.63
111 0.54
112 0.49
113 0.44
114 0.37
115 0.39
116 0.37
117 0.39
118 0.41
119 0.46
120 0.49
121 0.58
122 0.58
123 0.51
124 0.58
125 0.54
126 0.52
127 0.49
128 0.44
129 0.37
130 0.37
131 0.35
132 0.26
133 0.21
134 0.14
135 0.13
136 0.1
137 0.08
138 0.07
139 0.07
140 0.06
141 0.07
142 0.07
143 0.07
144 0.06
145 0.07
146 0.08
147 0.11
148 0.14