Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J747

Protein Details
Accession A0A397J747    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
75-97IFSLKVTSKLNKKSQRKWESNNEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9, pero 4, E.R. 4, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGENLAELTEFDYGDDVIIVMMVSMMIIKIIRLHPIQKKYRHINNEDSMDLDSIEPIATKYSGIIDKISFIDEEIFSLKVTSKLNKKSQRKWESNNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.05
4 0.04
5 0.04
6 0.04
7 0.03
8 0.03
9 0.02
10 0.02
11 0.02
12 0.02
13 0.03
14 0.03
15 0.03
16 0.06
17 0.07
18 0.11
19 0.12
20 0.19
21 0.25
22 0.34
23 0.42
24 0.46
25 0.54
26 0.59
27 0.66
28 0.67
29 0.64
30 0.63
31 0.6
32 0.56
33 0.48
34 0.4
35 0.33
36 0.25
37 0.21
38 0.13
39 0.08
40 0.05
41 0.05
42 0.04
43 0.04
44 0.05
45 0.04
46 0.04
47 0.05
48 0.07
49 0.09
50 0.1
51 0.11
52 0.1
53 0.11
54 0.12
55 0.13
56 0.1
57 0.09
58 0.11
59 0.09
60 0.1
61 0.1
62 0.1
63 0.09
64 0.1
65 0.11
66 0.13
67 0.16
68 0.22
69 0.29
70 0.38
71 0.48
72 0.58
73 0.67
74 0.73
75 0.82
76 0.85
77 0.86