Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J1P6

Protein Details
Accession A0A397J1P6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-38TTKVKKYIIKLIKKIKEKKEKKKLLKKLKAKEVMEBasic
NLS Segment(s)
PositionSequence
11-34IIKLIKKIKEKKEKKKLLKKLKAK
Subcellular Location(s) cyto 11, cyto_nucl 11, nucl 9, mito 7
Family & Domain DBs
Amino Acid Sequences MNFTTKVKKYIIKLIKKIKEKKEKKKLLKKLKAKEVMEEVFKLEKEKKLVEEENNSSAGFDYPRIFFLTKVVDGEVLFGDIVFGEPKDQEGMYVEFKGEGWNEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.78
4 0.83
5 0.83
6 0.85
7 0.86
8 0.88
9 0.88
10 0.91
11 0.92
12 0.93
13 0.93
14 0.94
15 0.93
16 0.92
17 0.9
18 0.9
19 0.88
20 0.78
21 0.71
22 0.66
23 0.58
24 0.49
25 0.4
26 0.32
27 0.24
28 0.23
29 0.22
30 0.18
31 0.18
32 0.19
33 0.2
34 0.2
35 0.23
36 0.27
37 0.27
38 0.3
39 0.3
40 0.29
41 0.29
42 0.26
43 0.21
44 0.18
45 0.15
46 0.1
47 0.09
48 0.09
49 0.08
50 0.1
51 0.12
52 0.12
53 0.12
54 0.14
55 0.16
56 0.15
57 0.15
58 0.14
59 0.13
60 0.12
61 0.13
62 0.11
63 0.08
64 0.07
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.07
74 0.09
75 0.09
76 0.09
77 0.11
78 0.15
79 0.17
80 0.17
81 0.17
82 0.15
83 0.16
84 0.18