Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IX89

Protein Details
Accession A0A397IX89    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-40CGGLLWKRPKRMSKTRKANVRKRLKAVDKHydrophilic
NLS Segment(s)
PositionSequence
18-36KRPKRMSKTRKANVRKRLK
Subcellular Location(s) mito 18.5, cyto_mito 12.833, cyto 6, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKATMAVCGGLLWKRPKRMSKTRKANVRKRLKAVDKVVAAVAASGIKCKALTLALQLPKECEMTPRDKYTVFSRKHKGYRKGFHLVPKFTKLTMRTTPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.17
3 0.25
4 0.3
5 0.37
6 0.44
7 0.53
8 0.6
9 0.69
10 0.74
11 0.76
12 0.82
13 0.83
14 0.87
15 0.88
16 0.89
17 0.88
18 0.88
19 0.84
20 0.8
21 0.81
22 0.77
23 0.75
24 0.7
25 0.66
26 0.55
27 0.49
28 0.42
29 0.32
30 0.25
31 0.16
32 0.12
33 0.06
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.08
44 0.14
45 0.18
46 0.19
47 0.19
48 0.2
49 0.2
50 0.21
51 0.18
52 0.15
53 0.15
54 0.2
55 0.25
56 0.27
57 0.28
58 0.27
59 0.3
60 0.36
61 0.42
62 0.41
63 0.46
64 0.5
65 0.57
66 0.66
67 0.73
68 0.74
69 0.75
70 0.79
71 0.78
72 0.78
73 0.74
74 0.74
75 0.73
76 0.71
77 0.66
78 0.63
79 0.57
80 0.5
81 0.53
82 0.45
83 0.44
84 0.44
85 0.46