Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IWV4

Protein Details
Accession A0A397IWV4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-29IGIQCQYSPHKKRGRPKIEKINRITNIHydrophilic
NLS Segment(s)
PositionSequence
13-20KKRGRPKI
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MNIGIQCQYSPHKKRGRPKIEKINRITNIETSNSGKIHPSSFSQTNNFPQLNDLVNNFSFTNNSLQLDDFSFIRGSPQVNNLVNDFSFHSIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.77
3 0.81
4 0.81
5 0.85
6 0.87
7 0.88
8 0.9
9 0.86
10 0.85
11 0.78
12 0.71
13 0.63
14 0.55
15 0.47
16 0.39
17 0.35
18 0.27
19 0.26
20 0.22
21 0.21
22 0.19
23 0.17
24 0.17
25 0.16
26 0.15
27 0.18
28 0.2
29 0.22
30 0.23
31 0.25
32 0.27
33 0.3
34 0.28
35 0.22
36 0.2
37 0.2
38 0.19
39 0.17
40 0.15
41 0.13
42 0.13
43 0.14
44 0.14
45 0.12
46 0.11
47 0.12
48 0.15
49 0.13
50 0.14
51 0.13
52 0.13
53 0.14
54 0.15
55 0.15
56 0.11
57 0.12
58 0.11
59 0.1
60 0.11
61 0.12
62 0.12
63 0.13
64 0.17
65 0.23
66 0.26
67 0.28
68 0.27
69 0.28
70 0.27
71 0.26
72 0.25