Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GCJ0

Protein Details
Accession A0A397GCJ0    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
34-61EGEKLRIKKKNNRMKWLKKNYYLERFVRHydrophilic
NLS Segment(s)
PositionSequence
38-48LRIKKKNNRMK
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
Amino Acid Sequences MDLKDIINEFSKDHSEEYSGEFNGEYNEKCNGGEGEKLRIKKKNNRMKWLKKNYYLERFVRANINKIYIEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.18
4 0.21
5 0.21
6 0.18
7 0.17
8 0.16
9 0.15
10 0.15
11 0.16
12 0.12
13 0.1
14 0.11
15 0.12
16 0.11
17 0.13
18 0.11
19 0.11
20 0.14
21 0.14
22 0.19
23 0.22
24 0.25
25 0.28
26 0.33
27 0.39
28 0.45
29 0.55
30 0.59
31 0.65
32 0.72
33 0.79
34 0.84
35 0.88
36 0.9
37 0.88
38 0.86
39 0.87
40 0.86
41 0.84
42 0.8
43 0.72
44 0.67
45 0.6
46 0.53
47 0.53
48 0.47
49 0.45
50 0.4
51 0.42