Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UYM4

Protein Details
Accession A0A397UYM4    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
48-76VATDDCKSRCKKQCKKLKGREWDNCYNGCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, E.R. 5, extr 4, plas 3, nucl 2, cyto 2, cyto_nucl 2, pero 2, golg 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNFYAIFHLFIIISISLTVGHPLVIRTQSDSNLLSSKRSTKSEFVRLVATDDCKSRCKKQCKKLKGREWDNCYNGCRINCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.08
6 0.06
7 0.06
8 0.06
9 0.07
10 0.1
11 0.11
12 0.11
13 0.14
14 0.15
15 0.16
16 0.18
17 0.18
18 0.17
19 0.19
20 0.19
21 0.17
22 0.17
23 0.22
24 0.22
25 0.24
26 0.26
27 0.27
28 0.32
29 0.39
30 0.4
31 0.36
32 0.34
33 0.32
34 0.31
35 0.27
36 0.25
37 0.18
38 0.18
39 0.2
40 0.23
41 0.27
42 0.34
43 0.42
44 0.51
45 0.6
46 0.67
47 0.75
48 0.82
49 0.89
50 0.91
51 0.91
52 0.91
53 0.91
54 0.91
55 0.89
56 0.87
57 0.8
58 0.74
59 0.67
60 0.6
61 0.56