Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VJK9

Protein Details
Accession A0A397VJK9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-97VKKGKKKKEVDVKKEKEKERSRRCKKRKEKERSRRCKKEKEKKEVEEKIERIBasic
NLS Segment(s)
PositionSequence
37-92EKKKKEVEGVKKGKKKKEVDVKKEKEKERSRRCKKRKEKERSRRCKKEKEKKEVEE
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MNNSATTTAITTIEPTRRRYKANRETALQVTAMVKLEKKKKEVEGVKKGKKKKEVDVKKEKEKERSRRCKKRKEKERSRRCKKEKEKKEVEEKIERIIERH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.4
4 0.42
5 0.49
6 0.55
7 0.61
8 0.64
9 0.71
10 0.7
11 0.65
12 0.67
13 0.62
14 0.55
15 0.44
16 0.34
17 0.24
18 0.2
19 0.17
20 0.13
21 0.13
22 0.17
23 0.25
24 0.28
25 0.31
26 0.34
27 0.36
28 0.44
29 0.51
30 0.55
31 0.58
32 0.64
33 0.7
34 0.72
35 0.75
36 0.72
37 0.72
38 0.66
39 0.64
40 0.65
41 0.67
42 0.71
43 0.76
44 0.77
45 0.78
46 0.82
47 0.77
48 0.77
49 0.76
50 0.77
51 0.77
52 0.81
53 0.82
54 0.86
55 0.92
56 0.93
57 0.94
58 0.94
59 0.94
60 0.94
61 0.94
62 0.94
63 0.96
64 0.96
65 0.96
66 0.96
67 0.94
68 0.94
69 0.94
70 0.94
71 0.94
72 0.93
73 0.93
74 0.9
75 0.92
76 0.89
77 0.85
78 0.84
79 0.75
80 0.7
81 0.66