Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UEH2

Protein Details
Accession A0A397UEH2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
158-178TDDYERTTNRQKQRRDSNSSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.333, cyto 6, cyto_pero 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR007858  Dpy-30_motif  
IPR037856  Sdc1/DPY30  
Gene Ontology GO:0048188  C:Set1C/COMPASS complex  
Pfam View protein in Pfam  
PF05186  Dpy-30  
CDD cd22965  DD_DPY30_SDC1  
Amino Acid Sequences MYAPSADDSMYTDSSPAETSNNEYENGQHGIGADILNADSQSPIKREEPEVDITGEEPSATEDQPSPLKFDDQFGEVVDEERDKIQRLNMRHPHNNTAVRDYLNKTVVPSLMAGLKRIVRERPADPCEFLGRYLIDHCQHDHTKDEYGSEMRIKHEDTDDYERTTNRQKQRRDSNSSLDVGSETDVDMMLNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.13
4 0.11
5 0.11
6 0.16
7 0.21
8 0.22
9 0.21
10 0.21
11 0.21
12 0.24
13 0.25
14 0.2
15 0.15
16 0.14
17 0.14
18 0.14
19 0.13
20 0.08
21 0.07
22 0.07
23 0.07
24 0.06
25 0.06
26 0.05
27 0.07
28 0.1
29 0.11
30 0.14
31 0.17
32 0.2
33 0.22
34 0.25
35 0.28
36 0.29
37 0.29
38 0.26
39 0.24
40 0.22
41 0.19
42 0.15
43 0.11
44 0.07
45 0.08
46 0.08
47 0.08
48 0.09
49 0.09
50 0.11
51 0.16
52 0.16
53 0.16
54 0.15
55 0.18
56 0.17
57 0.19
58 0.18
59 0.15
60 0.15
61 0.13
62 0.13
63 0.11
64 0.12
65 0.1
66 0.09
67 0.08
68 0.09
69 0.09
70 0.09
71 0.09
72 0.13
73 0.17
74 0.2
75 0.3
76 0.36
77 0.43
78 0.48
79 0.5
80 0.51
81 0.53
82 0.55
83 0.46
84 0.41
85 0.36
86 0.3
87 0.3
88 0.28
89 0.25
90 0.21
91 0.2
92 0.17
93 0.17
94 0.16
95 0.14
96 0.12
97 0.09
98 0.11
99 0.11
100 0.11
101 0.12
102 0.13
103 0.15
104 0.17
105 0.18
106 0.18
107 0.22
108 0.24
109 0.31
110 0.33
111 0.34
112 0.32
113 0.32
114 0.32
115 0.29
116 0.26
117 0.2
118 0.16
119 0.15
120 0.15
121 0.17
122 0.16
123 0.17
124 0.19
125 0.23
126 0.25
127 0.26
128 0.28
129 0.26
130 0.28
131 0.27
132 0.26
133 0.22
134 0.22
135 0.22
136 0.22
137 0.22
138 0.2
139 0.22
140 0.22
141 0.22
142 0.23
143 0.24
144 0.26
145 0.33
146 0.32
147 0.33
148 0.35
149 0.33
150 0.35
151 0.42
152 0.45
153 0.47
154 0.53
155 0.58
156 0.66
157 0.77
158 0.82
159 0.82
160 0.8
161 0.78
162 0.75
163 0.69
164 0.59
165 0.48
166 0.39
167 0.3
168 0.24
169 0.16
170 0.1
171 0.08
172 0.08