Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397W5Z6

Protein Details
Accession A0A397W5Z6    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-43PTGSNAVRNKTNKKKRNKKNSSKIEESLHydrophilic
NLS Segment(s)
PositionSequence
23-35RNKTNKKKRNKKN
88-91KARK
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MKDIKRIRRLVQRFEPTGSNAVRNKTNKKKRNKKNSSKIEESLNISSLVQSLPIIDAGPNFQPQPQTRKSHQKPPQTGLDIKPVKSQKARKRIMKEEIQRFHKVMQHSAFKADPLSTVKQHVENTIEKKENIPSDKSSMNVDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.62
3 0.54
4 0.53
5 0.45
6 0.41
7 0.36
8 0.37
9 0.41
10 0.45
11 0.53
12 0.57
13 0.66
14 0.68
15 0.76
16 0.83
17 0.86
18 0.91
19 0.92
20 0.93
21 0.93
22 0.95
23 0.92
24 0.88
25 0.8
26 0.74
27 0.66
28 0.59
29 0.5
30 0.4
31 0.31
32 0.24
33 0.21
34 0.16
35 0.12
36 0.08
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.08
46 0.08
47 0.08
48 0.09
49 0.14
50 0.16
51 0.23
52 0.27
53 0.32
54 0.36
55 0.47
56 0.51
57 0.57
58 0.62
59 0.65
60 0.64
61 0.62
62 0.64
63 0.57
64 0.56
65 0.47
66 0.49
67 0.42
68 0.37
69 0.4
70 0.35
71 0.34
72 0.39
73 0.46
74 0.45
75 0.54
76 0.61
77 0.63
78 0.7
79 0.74
80 0.74
81 0.74
82 0.75
83 0.74
84 0.74
85 0.72
86 0.67
87 0.6
88 0.55
89 0.5
90 0.43
91 0.39
92 0.37
93 0.38
94 0.35
95 0.38
96 0.35
97 0.31
98 0.3
99 0.24
100 0.21
101 0.19
102 0.22
103 0.21
104 0.25
105 0.26
106 0.29
107 0.3
108 0.31
109 0.31
110 0.33
111 0.37
112 0.41
113 0.42
114 0.39
115 0.4
116 0.43
117 0.46
118 0.44
119 0.43
120 0.39
121 0.4
122 0.42
123 0.41