Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397U152

Protein Details
Accession A0A397U152    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-30GSLNVQKKDKEKEQPKKLTAHydrophilic
159-181MNENENKRKDREHNERRGERDRSBasic
NLS Segment(s)
PositionSequence
42-45KKRK
165-191KRKDREHNERRGERDRSYDRESKRARR
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MSLSALAKKSGSLNVQKKDKEKEQPKKLTAMEQIIIDEMARKKRKEIMNENETKRKDKDREYNERRGERDRSYDRESMNENENKRKEYNERKDREYNERKDREYNERKDREYNERKDREYNERKDREYNERKDREYNERKDREYNERRERDRSYDRDSMNENENKRKDREHNERRGERDRSYDRESKRARRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.57
3 0.61
4 0.65
5 0.68
6 0.7
7 0.71
8 0.73
9 0.75
10 0.78
11 0.83
12 0.79
13 0.78
14 0.72
15 0.68
16 0.63
17 0.57
18 0.47
19 0.38
20 0.35
21 0.28
22 0.26
23 0.18
24 0.17
25 0.16
26 0.24
27 0.29
28 0.29
29 0.32
30 0.4
31 0.46
32 0.51
33 0.57
34 0.58
35 0.63
36 0.71
37 0.74
38 0.74
39 0.71
40 0.65
41 0.59
42 0.58
43 0.54
44 0.54
45 0.58
46 0.6
47 0.69
48 0.73
49 0.79
50 0.78
51 0.77
52 0.71
53 0.67
54 0.62
55 0.54
56 0.55
57 0.5
58 0.48
59 0.49
60 0.5
61 0.44
62 0.42
63 0.41
64 0.35
65 0.36
66 0.35
67 0.32
68 0.36
69 0.37
70 0.37
71 0.35
72 0.36
73 0.38
74 0.44
75 0.53
76 0.54
77 0.57
78 0.6
79 0.66
80 0.66
81 0.68
82 0.66
83 0.64
84 0.64
85 0.64
86 0.6
87 0.59
88 0.59
89 0.59
90 0.59
91 0.59
92 0.59
93 0.59
94 0.59
95 0.59
96 0.59
97 0.59
98 0.59
99 0.59
100 0.59
101 0.59
102 0.59
103 0.59
104 0.59
105 0.59
106 0.59
107 0.59
108 0.59
109 0.59
110 0.59
111 0.59
112 0.59
113 0.59
114 0.59
115 0.59
116 0.59
117 0.59
118 0.59
119 0.59
120 0.59
121 0.59
122 0.59
123 0.59
124 0.59
125 0.59
126 0.59
127 0.59
128 0.59
129 0.6
130 0.6
131 0.62
132 0.63
133 0.67
134 0.69
135 0.71
136 0.71
137 0.69
138 0.69
139 0.64
140 0.61
141 0.6
142 0.57
143 0.55
144 0.54
145 0.49
146 0.48
147 0.47
148 0.44
149 0.46
150 0.52
151 0.52
152 0.52
153 0.56
154 0.57
155 0.62
156 0.69
157 0.7
158 0.74
159 0.8
160 0.84
161 0.84
162 0.84
163 0.79
164 0.72
165 0.7
166 0.65
167 0.6
168 0.6
169 0.61
170 0.56
171 0.61
172 0.66