Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397WD74

Protein Details
Accession A0A397WD74    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-94QILNNCDKMKEKNKKKKKREREKKKERERESEKERKKESEKERVRKRERKREKEKEREREKERERKKERERKREREKEKERKREKKRKRERNBasic
NLS Segment(s)
PositionSequence
12-94KEKNKKKKKREREKKKERERESEKERKKESEKERVRKRERKREKEKEREREKERERKKERERKREREKEKERKREKKRKRERN
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MYQILNNCDKMKEKNKKKKKREREKKKERERESEKERKKESEKERVRKRERKREKEKEREREKERERKKERERKREREKEKERKREKKRKRERN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.77
3 0.85
4 0.92
5 0.95
6 0.95
7 0.96
8 0.96
9 0.96
10 0.97
11 0.97
12 0.97
13 0.97
14 0.96
15 0.92
16 0.91
17 0.88
18 0.86
19 0.85
20 0.84
21 0.81
22 0.79
23 0.75
24 0.71
25 0.68
26 0.68
27 0.66
28 0.66
29 0.68
30 0.7
31 0.76
32 0.8
33 0.84
34 0.84
35 0.86
36 0.86
37 0.88
38 0.88
39 0.9
40 0.9
41 0.91
42 0.93
43 0.94
44 0.93
45 0.92
46 0.9
47 0.85
48 0.85
49 0.83
50 0.82
51 0.81
52 0.82
53 0.8
54 0.81
55 0.86
56 0.86
57 0.88
58 0.88
59 0.9
60 0.9
61 0.93
62 0.94
63 0.92
64 0.93
65 0.93
66 0.93
67 0.93
68 0.93
69 0.93
70 0.93
71 0.95
72 0.95
73 0.95
74 0.95