Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UPP8

Protein Details
Accession A0A397UPP8    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
78-103LESKKEVSNRMKKKNREKKLLRGNEAHydrophilic
NLS Segment(s)
PositionSequence
86-97NRMKKKNREKKL
Subcellular Location(s) nucl 23, cyto_nucl 15.5
Family & Domain DBs
Amino Acid Sequences MQAQRDSSINSSEIDILRQQISELRKENDSLTDENTKTAKENAELKRSKILDIQNFSIIYPSNPKSLEEIEIDNSLDLESKKEVSNRMKKKNREKKLLRGNEAPASQTQESHNTSSTMPTPLIPPKVSISDGDNSSEVLLQSNGTNVPESLDSKTVKELWDQKQNKTSQHQCTLLLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.18
5 0.17
6 0.16
7 0.18
8 0.21
9 0.25
10 0.29
11 0.29
12 0.3
13 0.32
14 0.33
15 0.32
16 0.33
17 0.28
18 0.27
19 0.31
20 0.3
21 0.31
22 0.31
23 0.26
24 0.24
25 0.25
26 0.23
27 0.2
28 0.29
29 0.32
30 0.41
31 0.42
32 0.42
33 0.47
34 0.46
35 0.43
36 0.4
37 0.41
38 0.39
39 0.41
40 0.41
41 0.36
42 0.36
43 0.34
44 0.29
45 0.23
46 0.16
47 0.18
48 0.17
49 0.17
50 0.17
51 0.18
52 0.2
53 0.21
54 0.22
55 0.17
56 0.17
57 0.16
58 0.16
59 0.16
60 0.13
61 0.11
62 0.09
63 0.09
64 0.07
65 0.07
66 0.07
67 0.08
68 0.1
69 0.11
70 0.18
71 0.25
72 0.35
73 0.43
74 0.53
75 0.6
76 0.67
77 0.77
78 0.82
79 0.82
80 0.83
81 0.8
82 0.8
83 0.82
84 0.82
85 0.76
86 0.69
87 0.63
88 0.57
89 0.51
90 0.42
91 0.32
92 0.29
93 0.24
94 0.21
95 0.19
96 0.2
97 0.22
98 0.22
99 0.22
100 0.18
101 0.19
102 0.19
103 0.2
104 0.16
105 0.14
106 0.13
107 0.15
108 0.18
109 0.22
110 0.2
111 0.2
112 0.21
113 0.23
114 0.23
115 0.21
116 0.2
117 0.21
118 0.21
119 0.21
120 0.19
121 0.17
122 0.17
123 0.16
124 0.13
125 0.1
126 0.09
127 0.08
128 0.08
129 0.09
130 0.1
131 0.09
132 0.1
133 0.09
134 0.1
135 0.12
136 0.14
137 0.15
138 0.19
139 0.2
140 0.2
141 0.24
142 0.24
143 0.23
144 0.28
145 0.35
146 0.37
147 0.47
148 0.5
149 0.53
150 0.6
151 0.64
152 0.63
153 0.65
154 0.66
155 0.65
156 0.69
157 0.65