Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TZB7

Protein Details
Accession A0A397TZB7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-69ACEKERKREREREREREKVREKVREKEREREKEREKKREKKREBasic
NLS Segment(s)
PositionSequence
30-69KERKREREREREREKVREKVREKEREREKEREKKREKKRE
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MFMGMISGTKWEHKSIICVPYRDSFFACEKERKREREREREREKVREKVREKEREREKEREKKREKKRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.36
4 0.36
5 0.35
6 0.36
7 0.39
8 0.41
9 0.36
10 0.31
11 0.26
12 0.25
13 0.29
14 0.3
15 0.33
16 0.34
17 0.42
18 0.49
19 0.53
20 0.57
21 0.63
22 0.68
23 0.71
24 0.78
25 0.79
26 0.79
27 0.82
28 0.79
29 0.79
30 0.76
31 0.74
32 0.71
33 0.71
34 0.68
35 0.68
36 0.73
37 0.73
38 0.72
39 0.73
40 0.76
41 0.77
42 0.79
43 0.79
44 0.8
45 0.8
46 0.85
47 0.86
48 0.86
49 0.86