Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397V5H3

Protein Details
Accession A0A397V5H3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
128-147SPPPSTKTKKPNLQIYNNDKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006931  Calcipressin  
Gene Ontology GO:0019722  P:calcium-mediated signaling  
Pfam View protein in Pfam  
PF04847  Calcipressin  
Amino Acid Sequences MDNTRYLKVPEFEKNLLISPPGSPPVGWVQSREDRPNSATLSDDLVHALAKFHSNSSNNIYEDDFEEFTLDDKIESEESESRDSHNDSDSRNNAPILTIIPSVDVDNNTKYENKPDVPLILIQNWDDSPPPSTKTKKPNLQIYNNDKAQLRPNITHRPITRTPRPPFPSSQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.34
4 0.3
5 0.23
6 0.17
7 0.19
8 0.19
9 0.18
10 0.15
11 0.17
12 0.23
13 0.27
14 0.26
15 0.25
16 0.3
17 0.37
18 0.43
19 0.45
20 0.41
21 0.38
22 0.4
23 0.42
24 0.37
25 0.3
26 0.27
27 0.22
28 0.23
29 0.2
30 0.18
31 0.14
32 0.12
33 0.11
34 0.1
35 0.1
36 0.07
37 0.09
38 0.09
39 0.1
40 0.15
41 0.16
42 0.19
43 0.24
44 0.28
45 0.26
46 0.27
47 0.26
48 0.21
49 0.21
50 0.21
51 0.15
52 0.11
53 0.11
54 0.09
55 0.1
56 0.1
57 0.08
58 0.05
59 0.06
60 0.07
61 0.06
62 0.06
63 0.08
64 0.1
65 0.12
66 0.14
67 0.14
68 0.14
69 0.15
70 0.17
71 0.15
72 0.15
73 0.15
74 0.14
75 0.2
76 0.21
77 0.22
78 0.21
79 0.21
80 0.18
81 0.16
82 0.15
83 0.11
84 0.1
85 0.08
86 0.07
87 0.08
88 0.08
89 0.08
90 0.09
91 0.09
92 0.09
93 0.1
94 0.11
95 0.12
96 0.14
97 0.14
98 0.19
99 0.22
100 0.21
101 0.22
102 0.22
103 0.22
104 0.21
105 0.24
106 0.2
107 0.17
108 0.17
109 0.15
110 0.15
111 0.14
112 0.14
113 0.12
114 0.11
115 0.13
116 0.14
117 0.17
118 0.22
119 0.28
120 0.35
121 0.44
122 0.53
123 0.59
124 0.65
125 0.72
126 0.74
127 0.78
128 0.81
129 0.79
130 0.78
131 0.71
132 0.65
133 0.56
134 0.5
135 0.48
136 0.46
137 0.43
138 0.4
139 0.46
140 0.53
141 0.56
142 0.62
143 0.57
144 0.58
145 0.61
146 0.65
147 0.67
148 0.67
149 0.69
150 0.72
151 0.75
152 0.72