Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TZ89

Protein Details
Accession A0A397TZ89    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
118-144SIDTSNKQVKKRKYRSKSIRISNSPNSHydrophilic
NLS Segment(s)
PositionSequence
128-130KRK
Subcellular Location(s) nucl 20, cyto_nucl 13.833, mito_nucl 12.665
Family & Domain DBs
Amino Acid Sequences MAKRMRSDAVPLSPEDYKFIMQYRDAKPKTDILKKLREKYPMTNNRFYKIWRGQEVSMIEWYQPISELITLPSQDLPIPELLPESCLPSIGYTSSTEGTSSITENSNKSNKDILHLTSIDTSNKQVKKRKYRSKSIRISNSPNSGASAKVHIISGGDIPNILTEKVENGDLYTLIERNRKETEEAERESERILNFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.27
4 0.22
5 0.21
6 0.24
7 0.23
8 0.24
9 0.32
10 0.36
11 0.45
12 0.45
13 0.46
14 0.46
15 0.5
16 0.54
17 0.55
18 0.56
19 0.53
20 0.63
21 0.68
22 0.74
23 0.72
24 0.72
25 0.67
26 0.67
27 0.71
28 0.71
29 0.7
30 0.71
31 0.67
32 0.63
33 0.6
34 0.53
35 0.52
36 0.49
37 0.49
38 0.45
39 0.46
40 0.43
41 0.47
42 0.47
43 0.39
44 0.32
45 0.26
46 0.2
47 0.17
48 0.16
49 0.11
50 0.09
51 0.08
52 0.06
53 0.06
54 0.07
55 0.07
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.09
63 0.08
64 0.08
65 0.08
66 0.07
67 0.08
68 0.07
69 0.09
70 0.09
71 0.1
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.08
78 0.09
79 0.07
80 0.09
81 0.09
82 0.09
83 0.09
84 0.08
85 0.09
86 0.08
87 0.08
88 0.08
89 0.09
90 0.1
91 0.11
92 0.15
93 0.18
94 0.18
95 0.19
96 0.23
97 0.21
98 0.23
99 0.24
100 0.22
101 0.21
102 0.21
103 0.2
104 0.18
105 0.2
106 0.17
107 0.16
108 0.17
109 0.21
110 0.25
111 0.31
112 0.37
113 0.45
114 0.56
115 0.66
116 0.74
117 0.75
118 0.82
119 0.86
120 0.89
121 0.89
122 0.88
123 0.87
124 0.83
125 0.82
126 0.77
127 0.72
128 0.63
129 0.53
130 0.46
131 0.36
132 0.31
133 0.24
134 0.2
135 0.16
136 0.15
137 0.14
138 0.12
139 0.12
140 0.11
141 0.12
142 0.11
143 0.1
144 0.09
145 0.09
146 0.1
147 0.11
148 0.1
149 0.08
150 0.07
151 0.09
152 0.11
153 0.12
154 0.1
155 0.1
156 0.11
157 0.11
158 0.12
159 0.12
160 0.13
161 0.16
162 0.21
163 0.21
164 0.25
165 0.29
166 0.3
167 0.31
168 0.34
169 0.4
170 0.43
171 0.46
172 0.47
173 0.44
174 0.42
175 0.4
176 0.4