Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TZB0

Protein Details
Accession A0A397TZB0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MVHNYRTTRSQRRNNSNVLFHydrophilic
27-60QGENRRSKKIKEKDCRARRRIRRKKNLCGRGGNRBasic
NLS Segment(s)
PositionSequence
31-61RRSKKIKEKDCRARRRIRRKKNLCGRGGNRK
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
Amino Acid Sequences MVHNYRTTRSQRRNNSNVLFGVIDTLQGENRRSKKIKEKDCRARRRIRRKKNLCGRGGNRKLAARGEIFTERNRLRVQVEDLEDRLREAKAGRNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.71
4 0.61
5 0.53
6 0.43
7 0.32
8 0.27
9 0.18
10 0.14
11 0.1
12 0.1
13 0.1
14 0.12
15 0.14
16 0.19
17 0.23
18 0.3
19 0.32
20 0.38
21 0.46
22 0.54
23 0.62
24 0.66
25 0.73
26 0.77
27 0.85
28 0.89
29 0.87
30 0.88
31 0.88
32 0.89
33 0.89
34 0.89
35 0.9
36 0.88
37 0.91
38 0.91
39 0.9
40 0.84
41 0.83
42 0.78
43 0.78
44 0.74
45 0.68
46 0.6
47 0.53
48 0.48
49 0.4
50 0.37
51 0.27
52 0.22
53 0.22
54 0.24
55 0.24
56 0.23
57 0.3
58 0.28
59 0.3
60 0.3
61 0.28
62 0.26
63 0.28
64 0.32
65 0.3
66 0.34
67 0.33
68 0.34
69 0.35
70 0.33
71 0.3
72 0.27
73 0.2
74 0.18
75 0.16