Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UC87

Protein Details
Accession A0A397UC87    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
92-113KETSTKKISRKKKVSINKVEHDHydrophilic
NLS Segment(s)
PositionSequence
98-104KISRKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.333, mito_nucl 12.666
Family & Domain DBs
Amino Acid Sequences MVTHLYQNFYRSNATRLSESDIMEIRDSREKIPNASKKMAEKFHIGACRVYEIWEHNERLQQGLDDWNDLSPPDPNEDLTLDKPHTKEILAKETSTKKISRKKKVSINKVEHDTKVSSHMVEKNISSIDNAQSAQTLSNISRRKADLEKLIKDTEKLAPMCPSLPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.31
4 0.36
5 0.33
6 0.32
7 0.32
8 0.29
9 0.28
10 0.27
11 0.26
12 0.22
13 0.26
14 0.26
15 0.26
16 0.32
17 0.32
18 0.36
19 0.46
20 0.51
21 0.5
22 0.54
23 0.54
24 0.53
25 0.59
26 0.57
27 0.5
28 0.46
29 0.42
30 0.42
31 0.43
32 0.37
33 0.32
34 0.28
35 0.28
36 0.24
37 0.22
38 0.18
39 0.16
40 0.21
41 0.24
42 0.25
43 0.24
44 0.27
45 0.26
46 0.25
47 0.23
48 0.17
49 0.13
50 0.16
51 0.15
52 0.13
53 0.13
54 0.11
55 0.11
56 0.11
57 0.1
58 0.08
59 0.08
60 0.1
61 0.1
62 0.1
63 0.11
64 0.12
65 0.13
66 0.13
67 0.14
68 0.13
69 0.15
70 0.15
71 0.15
72 0.15
73 0.13
74 0.16
75 0.17
76 0.24
77 0.23
78 0.23
79 0.27
80 0.3
81 0.33
82 0.32
83 0.33
84 0.33
85 0.41
86 0.51
87 0.57
88 0.61
89 0.66
90 0.73
91 0.79
92 0.82
93 0.83
94 0.81
95 0.77
96 0.75
97 0.71
98 0.61
99 0.55
100 0.45
101 0.35
102 0.32
103 0.26
104 0.2
105 0.21
106 0.24
107 0.23
108 0.24
109 0.23
110 0.2
111 0.2
112 0.2
113 0.17
114 0.15
115 0.15
116 0.15
117 0.15
118 0.13
119 0.13
120 0.14
121 0.13
122 0.11
123 0.11
124 0.11
125 0.18
126 0.23
127 0.23
128 0.28
129 0.29
130 0.34
131 0.37
132 0.42
133 0.44
134 0.48
135 0.53
136 0.53
137 0.56
138 0.52
139 0.47
140 0.44
141 0.4
142 0.39
143 0.34
144 0.32
145 0.31
146 0.32