Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VGX9

Protein Details
Accession A0A397VGX9    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-74DPPITYPMPKRPRKPPAGYEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 8, E.R. 4, cyto 3, nucl 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR039961  Nuo9.5  
Gene Ontology GO:0016020  C:membrane  
CDD cd22903  NI9M  
Amino Acid Sequences MTIPFVTGPLNFLRRMATENTVYFWSLSVGILGPVLVVTVPPIRERYLGYVRPEDPPITYPMPKRPRKPPAGYEDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.23
4 0.22
5 0.22
6 0.23
7 0.24
8 0.23
9 0.23
10 0.19
11 0.16
12 0.13
13 0.1
14 0.09
15 0.07
16 0.06
17 0.05
18 0.05
19 0.05
20 0.04
21 0.03
22 0.03
23 0.02
24 0.02
25 0.03
26 0.04
27 0.05
28 0.06
29 0.08
30 0.09
31 0.1
32 0.12
33 0.17
34 0.23
35 0.27
36 0.3
37 0.33
38 0.33
39 0.35
40 0.36
41 0.31
42 0.26
43 0.23
44 0.25
45 0.24
46 0.27
47 0.29
48 0.37
49 0.47
50 0.53
51 0.59
52 0.64
53 0.71
54 0.76
55 0.81
56 0.8