Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TPF9

Protein Details
Accession A0A397TPF9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-58RNPGQLKDKARNKKFHRRRIGIEBasic
NLS Segment(s)
PositionSequence
44-54KARNKKFHRRR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
IPR017884  SANT_dom  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
PS51293  SANT  
CDD cd11660  SANT_TRF  
Amino Acid Sequences RNKWTKEELNALEAGMEKYKTSWKKICEEYAILCNRNPGQLKDKARNKKFHRRRIGIEIGVFNLATDTRDPSQGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.15
3 0.13
4 0.1
5 0.11
6 0.19
7 0.22
8 0.28
9 0.32
10 0.35
11 0.42
12 0.46
13 0.49
14 0.44
15 0.43
16 0.38
17 0.4
18 0.39
19 0.33
20 0.29
21 0.27
22 0.24
23 0.26
24 0.25
25 0.2
26 0.22
27 0.29
28 0.34
29 0.41
30 0.5
31 0.56
32 0.62
33 0.69
34 0.72
35 0.76
36 0.81
37 0.82
38 0.84
39 0.8
40 0.8
41 0.79
42 0.78
43 0.7
44 0.63
45 0.54
46 0.44
47 0.38
48 0.31
49 0.22
50 0.15
51 0.12
52 0.09
53 0.09
54 0.13
55 0.14