Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UCQ5

Protein Details
Accession A0A397UCQ5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-80TISENKDKTRKPKKKEKKDTYLPASRSHydrophilic
NLS Segment(s)
PositionSequence
44-71PTMRKPEKKRTISENKDKTRKPKKKEKK
Subcellular Location(s) mito 13, nucl 11, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MLLELLYPKRKLPVGSNLAGISANKAKPIAGPKVAGSRISSLIPTMRKPEKKRTISENKDKTRKPKKKEKKDTYLPASRSQALFSSPVFKDSSPISITFEANL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.43
4 0.38
5 0.36
6 0.34
7 0.27
8 0.21
9 0.19
10 0.18
11 0.16
12 0.16
13 0.16
14 0.18
15 0.24
16 0.25
17 0.22
18 0.23
19 0.24
20 0.3
21 0.31
22 0.28
23 0.24
24 0.21
25 0.2
26 0.19
27 0.17
28 0.12
29 0.15
30 0.16
31 0.16
32 0.2
33 0.25
34 0.32
35 0.37
36 0.48
37 0.54
38 0.57
39 0.6
40 0.64
41 0.68
42 0.69
43 0.75
44 0.74
45 0.72
46 0.75
47 0.75
48 0.76
49 0.76
50 0.77
51 0.75
52 0.76
53 0.79
54 0.82
55 0.9
56 0.9
57 0.89
58 0.91
59 0.92
60 0.89
61 0.86
62 0.78
63 0.73
64 0.67
65 0.59
66 0.49
67 0.4
68 0.33
69 0.26
70 0.25
71 0.19
72 0.22
73 0.19
74 0.21
75 0.21
76 0.2
77 0.21
78 0.2
79 0.25
80 0.2
81 0.21
82 0.23
83 0.24