Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TNV0

Protein Details
Accession A0A397TNV0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
65-90DSQAIPARKKKKTGKKVHNLGKNISKHydrophilic
NLS Segment(s)
PositionSequence
70-83PARKKKKTGKKVHN
Subcellular Location(s) nucl 19, cyto_nucl 14.5, cyto 8
Family & Domain DBs
Amino Acid Sequences MGELTNVDEEIKTTSDSNFIAFLDEVKSDYQTCFKSGTYICVQVESIKQRKVKGGTKNKENAMLDSQAIPARKKKKTGKKVHNLGKNISKNQPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.15
4 0.15
5 0.13
6 0.12
7 0.12
8 0.11
9 0.12
10 0.1
11 0.1
12 0.1
13 0.1
14 0.11
15 0.1
16 0.11
17 0.15
18 0.14
19 0.15
20 0.16
21 0.15
22 0.19
23 0.18
24 0.22
25 0.2
26 0.22
27 0.21
28 0.2
29 0.2
30 0.17
31 0.2
32 0.21
33 0.23
34 0.24
35 0.27
36 0.27
37 0.32
38 0.37
39 0.4
40 0.44
41 0.52
42 0.54
43 0.61
44 0.65
45 0.62
46 0.62
47 0.56
48 0.49
49 0.41
50 0.35
51 0.27
52 0.22
53 0.22
54 0.18
55 0.19
56 0.19
57 0.23
58 0.31
59 0.35
60 0.43
61 0.53
62 0.61
63 0.7
64 0.79
65 0.83
66 0.85
67 0.91
68 0.92
69 0.9
70 0.84
71 0.8
72 0.79
73 0.76
74 0.72