Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397V9I5

Protein Details
Accession A0A397V9I5    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-21GRKKIQIKPIKDERNRQVTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 2.5, cyto_mito 2.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR033896  MADS_MEF2-like  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0046983  F:protein dimerization activity  
GO:0000977  F:RNA polymerase II transcription regulatory region sequence-specific DNA binding  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS00350  MADS_BOX_1  
PS50066  MADS_BOX_2  
CDD cd00265  MADS_MEF2_like  
Amino Acid Sequences MGRKKIQIKPIKDERNRQVTFLKRKYGLMKKAYELSVLCDCEIALIIFNSNNKLVQYASTDIDKILLKYTEVYFVQFVAFIEINFLLNLLNFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.75
4 0.68
5 0.65
6 0.64
7 0.67
8 0.63
9 0.61
10 0.52
11 0.55
12 0.61
13 0.62
14 0.61
15 0.57
16 0.54
17 0.49
18 0.51
19 0.48
20 0.41
21 0.32
22 0.28
23 0.25
24 0.22
25 0.19
26 0.15
27 0.14
28 0.12
29 0.12
30 0.08
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.06
37 0.06
38 0.07
39 0.07
40 0.08
41 0.07
42 0.08
43 0.11
44 0.12
45 0.13
46 0.13
47 0.13
48 0.12
49 0.15
50 0.14
51 0.12
52 0.12
53 0.11
54 0.11
55 0.13
56 0.14
57 0.17
58 0.16
59 0.17
60 0.15
61 0.15
62 0.15
63 0.13
64 0.12
65 0.12
66 0.12
67 0.1
68 0.12
69 0.12
70 0.13
71 0.12
72 0.12
73 0.07