Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UUY3

Protein Details
Accession A0A397UUY3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-118MGQKVRRKTARKREQRMDKQTKIRPRTKEENDKKTRRKRWTKTRKKRQENRRKQEQERTKDSTKKKKESTRKPQQKWRTYLPKNDKFTKRTHRKLTKKLPKKPTEKRRRTLNKSTENDBasic
NLS Segment(s)
PositionSequence
4-110KVRRKTARKREQRMDKQTKIRPRTKEENDKKTRRKRWTKTRKKRQENRRKQEQERTKDSTKKKKESTRKPQQKWRTYLPKNDKFTKRTHRKLTKKLPKKPTEKRRRT
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
Amino Acid Sequences MGQKVRRKTARKREQRMDKQTKIRPRTKEENDKKTRRKRWTKTRKKRQENRRKQEQERTKDSTKKKKESTRKPQQKWRTYLPKNDKFTKRTHRKLTKKLPKKPTEKRRRTLNKSTEND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.94
4 0.93
5 0.91
6 0.89
7 0.88
8 0.87
9 0.85
10 0.82
11 0.78
12 0.76
13 0.78
14 0.78
15 0.81
16 0.81
17 0.83
18 0.85
19 0.88
20 0.89
21 0.9
22 0.89
23 0.89
24 0.9
25 0.89
26 0.9
27 0.91
28 0.93
29 0.94
30 0.95
31 0.96
32 0.96
33 0.95
34 0.95
35 0.95
36 0.95
37 0.93
38 0.93
39 0.9
40 0.85
41 0.86
42 0.84
43 0.8
44 0.76
45 0.73
46 0.67
47 0.66
48 0.69
49 0.69
50 0.68
51 0.69
52 0.7
53 0.73
54 0.78
55 0.81
56 0.84
57 0.85
58 0.87
59 0.87
60 0.89
61 0.9
62 0.88
63 0.83
64 0.82
65 0.81
66 0.76
67 0.79
68 0.79
69 0.78
70 0.75
71 0.79
72 0.76
73 0.69
74 0.72
75 0.73
76 0.73
77 0.74
78 0.78
79 0.8
80 0.82
81 0.9
82 0.92
83 0.92
84 0.91
85 0.92
86 0.92
87 0.91
88 0.91
89 0.92
90 0.92
91 0.92
92 0.92
93 0.9
94 0.91
95 0.92
96 0.9
97 0.9
98 0.89