Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L7J7

Protein Details
Accession E2L7J7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-23QFFIRYRHRVIRTRLRQPKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG mpr:MPER_01859  -  
Pfam View protein in Pfam  
PF00153  Mito_carr  
PROSITE View protein in PROSITE  
PS50920  SOLCAR  
Amino Acid Sequences MVCQFFIRYRHRVIRTRLRQPKVNGIVKYKGLVQTLRLVIKEEGARALYGGLSAHLMRVVPNAAVMYSIYEGVMRWGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.8
4 0.82
5 0.78
6 0.78
7 0.74
8 0.76
9 0.74
10 0.71
11 0.64
12 0.59
13 0.56
14 0.49
15 0.46
16 0.37
17 0.31
18 0.25
19 0.22
20 0.19
21 0.2
22 0.21
23 0.22
24 0.19
25 0.19
26 0.17
27 0.19
28 0.18
29 0.13
30 0.12
31 0.11
32 0.11
33 0.08
34 0.09
35 0.06
36 0.05
37 0.05
38 0.04
39 0.05
40 0.05
41 0.05
42 0.06
43 0.06
44 0.06
45 0.07
46 0.08
47 0.07
48 0.08
49 0.08
50 0.07
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08