Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TUH1

Protein Details
Accession A0A397TUH1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-69GVQPYKKEKEFKPRRKRTNLNLQNNKIHydrophilic
NLS Segment(s)
PositionSequence
49-59KEKEFKPRRKR
Subcellular Location(s) nucl 15, mito 7, cyto 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
Amino Acid Sequences MAVYTWTLFMQITWTLGQCPNMSVFTSALCSNMQHLISISLPGVQPYKKEKEFKPRRKRTNLNLQNNKIGSERGKALVEALCMNTMLTSLNLYENNLESDVREALAVAQLCLIPSLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.16
4 0.19
5 0.16
6 0.17
7 0.17
8 0.17
9 0.17
10 0.16
11 0.14
12 0.12
13 0.14
14 0.13
15 0.12
16 0.11
17 0.11
18 0.11
19 0.14
20 0.13
21 0.11
22 0.12
23 0.12
24 0.12
25 0.12
26 0.1
27 0.09
28 0.09
29 0.09
30 0.11
31 0.1
32 0.13
33 0.18
34 0.25
35 0.28
36 0.34
37 0.38
38 0.47
39 0.58
40 0.66
41 0.72
42 0.75
43 0.8
44 0.84
45 0.87
46 0.84
47 0.85
48 0.84
49 0.84
50 0.83
51 0.76
52 0.71
53 0.64
54 0.57
55 0.46
56 0.37
57 0.28
58 0.21
59 0.2
60 0.16
61 0.16
62 0.15
63 0.16
64 0.15
65 0.14
66 0.13
67 0.12
68 0.1
69 0.09
70 0.09
71 0.08
72 0.07
73 0.06
74 0.05
75 0.05
76 0.06
77 0.08
78 0.09
79 0.1
80 0.11
81 0.11
82 0.13
83 0.13
84 0.12
85 0.11
86 0.13
87 0.12
88 0.11
89 0.1
90 0.09
91 0.08
92 0.13
93 0.13
94 0.1
95 0.11
96 0.11
97 0.11