Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VHH8

Protein Details
Accession A0A397VHH8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-42AKQQETRRIKQKKWGRKRQETKRKKIDENIBasic
NLS Segment(s)
PositionSequence
18-37TRRIKQKKWGRKRQETKRKK
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MNKAKENKSQTGAKQQETRRIKQKKWGRKRQETKRKKIDENIPTTALTTASTTLQQHSNNGPNDNFVKAPAMITEKKIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.63
4 0.62
5 0.64
6 0.64
7 0.67
8 0.64
9 0.66
10 0.72
11 0.72
12 0.77
13 0.81
14 0.81
15 0.84
16 0.92
17 0.93
18 0.94
19 0.93
20 0.92
21 0.92
22 0.88
23 0.82
24 0.79
25 0.77
26 0.74
27 0.69
28 0.61
29 0.52
30 0.45
31 0.41
32 0.33
33 0.24
34 0.16
35 0.11
36 0.08
37 0.08
38 0.1
39 0.1
40 0.11
41 0.16
42 0.16
43 0.18
44 0.22
45 0.29
46 0.3
47 0.33
48 0.31
49 0.31
50 0.32
51 0.32
52 0.27
53 0.2
54 0.2
55 0.17
56 0.17
57 0.16
58 0.21
59 0.21