Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TV34

Protein Details
Accession A0A397TV34    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-92LKIRTKEYRKLGRRNEKLNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR044650  SRFR1-like  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Gene Ontology GO:0045892  P:negative regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF13181  TPR_8  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MLDICYSLKIHVKEYRNLGMHNKTLNELLDIYPNNPYLLKIRAEEYSKLGKHYEALNDLNRLLDIYPNNPYLLKIRTKEYRKLGRRNEKLNNLNRLLDIYPNDKNLLRVQGEVMIDITTKLLKMFPNNEQILRIRAQAYIAISKYDEALFDLNRLLKTNRNNEEILSIRAQTYTVIEKYDKASDDLNRLLKINSNNRKAFECSLLMDEMDEERLYNKMKNHFDRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.5
4 0.52
5 0.53
6 0.51
7 0.5
8 0.48
9 0.43
10 0.36
11 0.36
12 0.33
13 0.28
14 0.23
15 0.19
16 0.21
17 0.21
18 0.2
19 0.21
20 0.21
21 0.2
22 0.18
23 0.19
24 0.16
25 0.19
26 0.2
27 0.19
28 0.2
29 0.24
30 0.27
31 0.28
32 0.29
33 0.34
34 0.32
35 0.33
36 0.32
37 0.28
38 0.26
39 0.28
40 0.27
41 0.23
42 0.26
43 0.27
44 0.27
45 0.27
46 0.25
47 0.21
48 0.18
49 0.13
50 0.13
51 0.12
52 0.12
53 0.16
54 0.16
55 0.17
56 0.17
57 0.18
58 0.18
59 0.21
60 0.25
61 0.23
62 0.28
63 0.36
64 0.41
65 0.47
66 0.53
67 0.59
68 0.62
69 0.7
70 0.75
71 0.77
72 0.79
73 0.8
74 0.79
75 0.78
76 0.78
77 0.75
78 0.72
79 0.63
80 0.56
81 0.48
82 0.42
83 0.33
84 0.26
85 0.21
86 0.17
87 0.17
88 0.17
89 0.18
90 0.16
91 0.17
92 0.17
93 0.19
94 0.16
95 0.15
96 0.14
97 0.16
98 0.16
99 0.14
100 0.13
101 0.08
102 0.08
103 0.07
104 0.07
105 0.04
106 0.04
107 0.04
108 0.06
109 0.07
110 0.1
111 0.13
112 0.17
113 0.24
114 0.26
115 0.26
116 0.26
117 0.26
118 0.26
119 0.24
120 0.21
121 0.14
122 0.14
123 0.14
124 0.13
125 0.14
126 0.14
127 0.13
128 0.12
129 0.12
130 0.12
131 0.12
132 0.11
133 0.09
134 0.07
135 0.09
136 0.08
137 0.09
138 0.1
139 0.12
140 0.12
141 0.14
142 0.14
143 0.18
144 0.25
145 0.34
146 0.37
147 0.39
148 0.39
149 0.37
150 0.41
151 0.38
152 0.33
153 0.26
154 0.21
155 0.18
156 0.18
157 0.17
158 0.13
159 0.13
160 0.14
161 0.14
162 0.16
163 0.16
164 0.17
165 0.2
166 0.24
167 0.23
168 0.2
169 0.23
170 0.24
171 0.28
172 0.33
173 0.33
174 0.3
175 0.3
176 0.29
177 0.31
178 0.36
179 0.41
180 0.45
181 0.5
182 0.53
183 0.54
184 0.58
185 0.57
186 0.52
187 0.46
188 0.39
189 0.32
190 0.31
191 0.3
192 0.26
193 0.21
194 0.19
195 0.15
196 0.15
197 0.12
198 0.09
199 0.09
200 0.13
201 0.15
202 0.18
203 0.23
204 0.31
205 0.41