Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UWY5

Protein Details
Accession A0A397UWY5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-72IWAWCWEKGRKEKGTKEKRDKRRNBasic
NLS Segment(s)
PositionSequence
56-72KGRKEKGTKEKRDKRRN
Subcellular Location(s) cyto 13, nucl 12
Family & Domain DBs
Amino Acid Sequences MGPIRDPQDVPERELSAKSTLKGWCIIKVIKKSRKSVLLLVYDKIFKIIWAWCWEKGRKEKGTKEKRDKRRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.28
4 0.29
5 0.25
6 0.25
7 0.24
8 0.24
9 0.28
10 0.27
11 0.24
12 0.25
13 0.28
14 0.29
15 0.37
16 0.46
17 0.49
18 0.53
19 0.54
20 0.55
21 0.58
22 0.54
23 0.5
24 0.46
25 0.45
26 0.41
27 0.37
28 0.34
29 0.29
30 0.26
31 0.22
32 0.16
33 0.09
34 0.1
35 0.11
36 0.13
37 0.18
38 0.21
39 0.25
40 0.31
41 0.35
42 0.41
43 0.49
44 0.54
45 0.58
46 0.64
47 0.7
48 0.75
49 0.82
50 0.85
51 0.88
52 0.89