Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UW88

Protein Details
Accession A0A397UW88    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
43-65HFSLSPPKPKRLPKRQIDSEESQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040221  CDCA7/CDA7L  
IPR018866  Znf-4CXXC_R1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF10497  zf-4CXXC_R1  
Amino Acid Sequences MGRTSHKDEEPVPTYAVGEAYEKERLERIEQNRALLAKLGLIHFSLSPPKPKRLPKRQIDSEESQQEEHVRTPSRKSPRIQQMKPRYNLRVKSYRPIYATAAPIRHIIRPKSSTSKTKYKVLGRNNQGRRFYGGRIYDSELGTTCHQCRQKTIEEKVQCTNVLDNGTLCKVMMDERCLIGRYGETLEEARSSGEWNCPKCRGVCNCSFCRRKKGLPATGILKHLALSRGYNSVMEYLGDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.23
4 0.15
5 0.13
6 0.12
7 0.14
8 0.18
9 0.17
10 0.18
11 0.2
12 0.22
13 0.25
14 0.33
15 0.35
16 0.42
17 0.43
18 0.44
19 0.44
20 0.42
21 0.37
22 0.31
23 0.25
24 0.17
25 0.17
26 0.16
27 0.13
28 0.13
29 0.13
30 0.11
31 0.13
32 0.18
33 0.19
34 0.28
35 0.31
36 0.38
37 0.45
38 0.55
39 0.65
40 0.69
41 0.77
42 0.77
43 0.83
44 0.86
45 0.85
46 0.82
47 0.77
48 0.74
49 0.69
50 0.6
51 0.5
52 0.42
53 0.36
54 0.3
55 0.26
56 0.22
57 0.22
58 0.22
59 0.27
60 0.35
61 0.42
62 0.47
63 0.48
64 0.54
65 0.59
66 0.68
67 0.69
68 0.72
69 0.74
70 0.77
71 0.8
72 0.76
73 0.73
74 0.7
75 0.69
76 0.66
77 0.64
78 0.57
79 0.6
80 0.58
81 0.55
82 0.49
83 0.46
84 0.42
85 0.36
86 0.37
87 0.31
88 0.28
89 0.24
90 0.26
91 0.24
92 0.24
93 0.25
94 0.23
95 0.25
96 0.28
97 0.3
98 0.35
99 0.38
100 0.43
101 0.45
102 0.53
103 0.51
104 0.54
105 0.56
106 0.56
107 0.6
108 0.6
109 0.63
110 0.61
111 0.67
112 0.68
113 0.69
114 0.63
115 0.56
116 0.53
117 0.46
118 0.4
119 0.36
120 0.3
121 0.26
122 0.26
123 0.28
124 0.27
125 0.24
126 0.23
127 0.17
128 0.17
129 0.17
130 0.17
131 0.15
132 0.18
133 0.22
134 0.22
135 0.25
136 0.29
137 0.36
138 0.42
139 0.47
140 0.5
141 0.5
142 0.53
143 0.52
144 0.49
145 0.41
146 0.34
147 0.29
148 0.22
149 0.19
150 0.16
151 0.13
152 0.13
153 0.13
154 0.12
155 0.1
156 0.08
157 0.07
158 0.11
159 0.13
160 0.14
161 0.15
162 0.16
163 0.18
164 0.19
165 0.19
166 0.15
167 0.13
168 0.12
169 0.12
170 0.12
171 0.12
172 0.12
173 0.12
174 0.12
175 0.12
176 0.1
177 0.09
178 0.11
179 0.11
180 0.18
181 0.24
182 0.28
183 0.32
184 0.35
185 0.37
186 0.39
187 0.46
188 0.46
189 0.48
190 0.53
191 0.57
192 0.62
193 0.69
194 0.75
195 0.72
196 0.73
197 0.72
198 0.7
199 0.73
200 0.75
201 0.74
202 0.7
203 0.71
204 0.68
205 0.65
206 0.6
207 0.51
208 0.4
209 0.32
210 0.3
211 0.27
212 0.21
213 0.2
214 0.2
215 0.22
216 0.23
217 0.22
218 0.2
219 0.19
220 0.18