Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U4K5

Protein Details
Accession A0A397U4K5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
27-58FERERERKREREKENERGRKREREKEGEREREBasic
NLS Segment(s)
PositionSequence
30-61ERERKREREKENERGRKREREKEGEREREIRS
Subcellular Location(s) cyto 13cyto_nucl 13, nucl 11
Family & Domain DBs
Amino Acid Sequences MSEQNGNIKVIICVPYSDSFFGVACLFERERERKREREKENERGRKREREKEGEREREIRSERGSIKIFLGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.19
5 0.17
6 0.15
7 0.14
8 0.15
9 0.12
10 0.1
11 0.08
12 0.11
13 0.1
14 0.12
15 0.17
16 0.23
17 0.28
18 0.37
19 0.43
20 0.49
21 0.58
22 0.66
23 0.67
24 0.71
25 0.74
26 0.76
27 0.81
28 0.82
29 0.78
30 0.77
31 0.77
32 0.77
33 0.77
34 0.76
35 0.74
36 0.73
37 0.75
38 0.77
39 0.8
40 0.78
41 0.75
42 0.7
43 0.64
44 0.62
45 0.58
46 0.52
47 0.46
48 0.44
49 0.42
50 0.44
51 0.45
52 0.38