Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UKU8

Protein Details
Accession A0A397UKU8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-113TGDHIVKKKRRRVSRVITEFHydrophilic
NLS Segment(s)
PositionSequence
101-105KKRRR
Subcellular Location(s) nucl 19.5, cyto_nucl 15, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024610  ING_N_histone-binding  
Pfam View protein in Pfam  
PF12998  ING  
Amino Acid Sequences MEPIDANEYLIQYLGSIDNLPSEIHYHFTELTNKDQEIEQRIERRKKRLWCLYDGIPLEEDSDCSVMESVYEDQDTEDDDSDSEVEDRNEDEQTGDHIVKKKRRRVSRVITEFEDEEMLKDKIIKDYVRASQLQDEKIEIADKALALVSVFKYLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.08
6 0.09
7 0.09
8 0.09
9 0.1
10 0.1
11 0.13
12 0.13
13 0.15
14 0.15
15 0.18
16 0.24
17 0.24
18 0.29
19 0.29
20 0.29
21 0.28
22 0.28
23 0.29
24 0.28
25 0.3
26 0.29
27 0.34
28 0.43
29 0.52
30 0.56
31 0.6
32 0.62
33 0.67
34 0.72
35 0.74
36 0.7
37 0.66
38 0.65
39 0.61
40 0.59
41 0.51
42 0.42
43 0.33
44 0.28
45 0.23
46 0.18
47 0.15
48 0.09
49 0.08
50 0.07
51 0.07
52 0.07
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.09
81 0.11
82 0.11
83 0.13
84 0.19
85 0.25
86 0.34
87 0.42
88 0.48
89 0.55
90 0.64
91 0.69
92 0.73
93 0.77
94 0.8
95 0.8
96 0.76
97 0.69
98 0.62
99 0.55
100 0.45
101 0.36
102 0.25
103 0.18
104 0.16
105 0.14
106 0.12
107 0.13
108 0.14
109 0.16
110 0.21
111 0.2
112 0.2
113 0.26
114 0.31
115 0.33
116 0.34
117 0.32
118 0.36
119 0.4
120 0.39
121 0.34
122 0.31
123 0.27
124 0.27
125 0.26
126 0.17
127 0.14
128 0.12
129 0.11
130 0.1
131 0.1
132 0.09
133 0.07
134 0.1
135 0.1