Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W0A5

Protein Details
Accession A0A397W0A5    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
98-118ESKSYREKYRKVRQESRDKIVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040040  ATG11  
IPR019460  Atg11_C  
Gene Ontology GO:0034045  C:phagophore assembly site membrane  
GO:0005774  C:vacuolar membrane  
GO:0000045  P:autophagosome assembly  
GO:0000422  P:autophagy of mitochondrion  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF10377  ATG11  
Amino Acid Sequences MKSMELKIPTLADNYVMSITSMPQNVDDNKIGLSDSCYTEDLSQFFLDDNFDEQNLWPKDKYETLLSLAMKVKLDEVRGLIERALEEAEKLSQRYQAESKSYREKYRKVRQESRDKIVFQNFKVEDIVLFFPCNQLKKTQTAFKTYAAFNYNCPYYYLSDTGTIKNKNYIIGRITKISEHEAVCYPCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.12
5 0.1
6 0.11
7 0.13
8 0.14
9 0.13
10 0.14
11 0.18
12 0.2
13 0.24
14 0.23
15 0.2
16 0.19
17 0.19
18 0.18
19 0.14
20 0.15
21 0.13
22 0.14
23 0.16
24 0.16
25 0.17
26 0.18
27 0.2
28 0.17
29 0.17
30 0.14
31 0.12
32 0.12
33 0.11
34 0.11
35 0.09
36 0.11
37 0.09
38 0.09
39 0.09
40 0.1
41 0.19
42 0.2
43 0.21
44 0.19
45 0.2
46 0.23
47 0.24
48 0.26
49 0.19
50 0.19
51 0.2
52 0.24
53 0.23
54 0.23
55 0.23
56 0.22
57 0.19
58 0.18
59 0.17
60 0.14
61 0.15
62 0.12
63 0.11
64 0.12
65 0.13
66 0.13
67 0.11
68 0.1
69 0.09
70 0.09
71 0.09
72 0.06
73 0.05
74 0.05
75 0.07
76 0.08
77 0.08
78 0.08
79 0.12
80 0.12
81 0.14
82 0.16
83 0.17
84 0.22
85 0.24
86 0.27
87 0.33
88 0.36
89 0.42
90 0.45
91 0.5
92 0.55
93 0.63
94 0.68
95 0.68
96 0.75
97 0.76
98 0.82
99 0.81
100 0.77
101 0.72
102 0.65
103 0.59
104 0.58
105 0.53
106 0.42
107 0.44
108 0.37
109 0.33
110 0.32
111 0.28
112 0.19
113 0.18
114 0.2
115 0.11
116 0.12
117 0.1
118 0.13
119 0.16
120 0.18
121 0.16
122 0.19
123 0.22
124 0.28
125 0.33
126 0.38
127 0.38
128 0.43
129 0.45
130 0.43
131 0.44
132 0.38
133 0.38
134 0.35
135 0.32
136 0.28
137 0.3
138 0.27
139 0.24
140 0.25
141 0.22
142 0.2
143 0.24
144 0.23
145 0.2
146 0.24
147 0.26
148 0.29
149 0.34
150 0.34
151 0.31
152 0.36
153 0.35
154 0.36
155 0.37
156 0.36
157 0.34
158 0.38
159 0.4
160 0.38
161 0.39
162 0.35
163 0.35
164 0.36
165 0.36
166 0.29
167 0.3
168 0.32