Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397U539

Protein Details
Accession A0A397U539    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-60KETARFKTKHERNLKNEKRNDGBasic
NLS Segment(s)
Subcellular Location(s) extr 14, golg 6, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043504  Peptidase_S1_PA_chymotrypsin  
Amino Acid Sequences MNKKFSLYLLIVLIAIMVITSHTSVISQRNAFRAPERIKETARFKTKHERNLKNEKRNDGTTFDLKDLSFSPGYNIQKEGPLDPNKGNARLQDYTGALGWRFDIGNNTLTNVFGYPASGDMVNCTKDGKHLCEWQGNVQKDDYYYFIDDVDLGSGTSGSPLIFQYNRNEHLGYVYASIEAYANKTNESISPIWDEQIFLELLSKLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.04
4 0.03
5 0.03
6 0.04
7 0.04
8 0.05
9 0.05
10 0.06
11 0.09
12 0.14
13 0.2
14 0.23
15 0.25
16 0.3
17 0.32
18 0.34
19 0.34
20 0.39
21 0.38
22 0.42
23 0.45
24 0.45
25 0.47
26 0.52
27 0.56
28 0.56
29 0.6
30 0.54
31 0.54
32 0.6
33 0.64
34 0.67
35 0.7
36 0.7
37 0.7
38 0.8
39 0.85
40 0.83
41 0.82
42 0.79
43 0.74
44 0.69
45 0.63
46 0.55
47 0.5
48 0.45
49 0.4
50 0.34
51 0.3
52 0.25
53 0.24
54 0.21
55 0.2
56 0.15
57 0.13
58 0.15
59 0.2
60 0.22
61 0.22
62 0.22
63 0.19
64 0.22
65 0.22
66 0.22
67 0.22
68 0.24
69 0.26
70 0.25
71 0.31
72 0.3
73 0.32
74 0.31
75 0.25
76 0.27
77 0.25
78 0.25
79 0.21
80 0.19
81 0.17
82 0.17
83 0.15
84 0.1
85 0.09
86 0.08
87 0.06
88 0.06
89 0.06
90 0.07
91 0.08
92 0.1
93 0.1
94 0.11
95 0.1
96 0.1
97 0.1
98 0.09
99 0.08
100 0.05
101 0.05
102 0.04
103 0.05
104 0.06
105 0.06
106 0.05
107 0.07
108 0.09
109 0.09
110 0.09
111 0.09
112 0.09
113 0.13
114 0.16
115 0.19
116 0.21
117 0.26
118 0.29
119 0.33
120 0.34
121 0.38
122 0.44
123 0.41
124 0.38
125 0.33
126 0.31
127 0.27
128 0.27
129 0.2
130 0.15
131 0.14
132 0.13
133 0.12
134 0.12
135 0.11
136 0.1
137 0.09
138 0.06
139 0.05
140 0.05
141 0.05
142 0.04
143 0.05
144 0.05
145 0.04
146 0.05
147 0.06
148 0.1
149 0.11
150 0.13
151 0.21
152 0.27
153 0.3
154 0.32
155 0.32
156 0.28
157 0.29
158 0.29
159 0.22
160 0.17
161 0.15
162 0.12
163 0.12
164 0.12
165 0.1
166 0.09
167 0.11
168 0.14
169 0.14
170 0.14
171 0.15
172 0.16
173 0.16
174 0.21
175 0.19
176 0.17
177 0.23
178 0.23
179 0.24
180 0.24
181 0.23
182 0.18
183 0.2
184 0.17
185 0.11
186 0.13