Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VB03

Protein Details
Accession A0A397VB03    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MALNKLKSKIPPKKNTSTRKAKLKSFDHydrophilic
88-109WGKIKSPLSKVRKKGHGNKLVFHydrophilic
NLS Segment(s)
PositionSequence
8-21SKIPPKKNTSTRKA
99-101RKK
Subcellular Location(s) nucl 13, mito_nucl 12.333, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MALNKLKSKIPPKKNTSTRKAKLKSFDNDDCMNRLFFIKENIWRMQYYTAIANCLDQLNKETYVVEVLAPILTTFAKIPILVTYKTNWGKIKSPLSKVRKKGHGNKLVFILHIAISDKDLELVSIETG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.87
4 0.88
5 0.86
6 0.86
7 0.85
8 0.81
9 0.79
10 0.77
11 0.75
12 0.73
13 0.69
14 0.63
15 0.61
16 0.56
17 0.5
18 0.43
19 0.35
20 0.27
21 0.22
22 0.18
23 0.14
24 0.17
25 0.18
26 0.22
27 0.27
28 0.28
29 0.29
30 0.28
31 0.29
32 0.26
33 0.23
34 0.18
35 0.17
36 0.15
37 0.15
38 0.14
39 0.13
40 0.12
41 0.12
42 0.11
43 0.07
44 0.09
45 0.1
46 0.1
47 0.1
48 0.1
49 0.09
50 0.09
51 0.09
52 0.07
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.05
65 0.06
66 0.08
67 0.11
68 0.12
69 0.13
70 0.14
71 0.22
72 0.24
73 0.28
74 0.28
75 0.29
76 0.32
77 0.38
78 0.47
79 0.45
80 0.51
81 0.56
82 0.63
83 0.68
84 0.72
85 0.75
86 0.75
87 0.78
88 0.81
89 0.82
90 0.82
91 0.77
92 0.71
93 0.68
94 0.59
95 0.49
96 0.39
97 0.3
98 0.2
99 0.19
100 0.17
101 0.12
102 0.12
103 0.13
104 0.12
105 0.11
106 0.11
107 0.09
108 0.09