Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W797

Protein Details
Accession A0A397W797    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTKEFTANKKDPRRKLWKAYYKMIKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MTKEFTANKKDPRRKLWKAYYKMIKEPTMKQQMNSPYNSKATTSKNGNSNNDDSCSKYDNTNGNLKCDDTNNGSKDFEDLASDYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.86
4 0.86
5 0.83
6 0.84
7 0.83
8 0.78
9 0.76
10 0.7
11 0.65
12 0.59
13 0.57
14 0.57
15 0.57
16 0.53
17 0.46
18 0.47
19 0.5
20 0.5
21 0.48
22 0.41
23 0.34
24 0.35
25 0.35
26 0.3
27 0.26
28 0.26
29 0.28
30 0.3
31 0.31
32 0.36
33 0.4
34 0.42
35 0.41
36 0.4
37 0.36
38 0.34
39 0.32
40 0.27
41 0.24
42 0.24
43 0.21
44 0.2
45 0.24
46 0.26
47 0.29
48 0.36
49 0.34
50 0.34
51 0.35
52 0.35
53 0.31
54 0.28
55 0.28
56 0.26
57 0.33
58 0.31
59 0.33
60 0.32
61 0.31
62 0.3
63 0.28
64 0.22
65 0.17