Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UL96

Protein Details
Accession A0A397UL96    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-28CAQLLDRQKKSKKHEDPTKHRNRLPMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences YHCAQLLDRQKKSKKHEDPTKHRNRLPMQRFHCRGWLIITVDMEKLQVTINLTHEYYAEYVDVHVMNEIKEYIQTNLQQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.83
4 0.85
5 0.88
6 0.9
7 0.92
8 0.9
9 0.82
10 0.79
11 0.77
12 0.77
13 0.74
14 0.73
15 0.68
16 0.7
17 0.71
18 0.64
19 0.61
20 0.51
21 0.44
22 0.36
23 0.34
24 0.25
25 0.23
26 0.21
27 0.17
28 0.16
29 0.15
30 0.12
31 0.08
32 0.07
33 0.05
34 0.06
35 0.07
36 0.08
37 0.11
38 0.13
39 0.13
40 0.13
41 0.13
42 0.13
43 0.11
44 0.1
45 0.08
46 0.07
47 0.07
48 0.08
49 0.08
50 0.07
51 0.09
52 0.09
53 0.09
54 0.1
55 0.1
56 0.09
57 0.11
58 0.13
59 0.13
60 0.18