Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397U003

Protein Details
Accession A0A397U003    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MKPFKRRVKRRVKRRVKRRVRSVVDEESBasic
NLS Segment(s)
PositionSequence
3-21PFKRRVKRRVKRRVKRRVR
Subcellular Location(s) mito_nucl 6.833, mito 6.5, cyto_nucl 6.333, nucl 6, plas 6, cyto 5.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKPFKRRVKRRVKRRVKRRVRSVVDEESNEESEALWTKSQKRRRVGSVMGRNLTSLKVLLFVLIFTLHLIAKSDLRYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.95
3 0.95
4 0.95
5 0.94
6 0.94
7 0.9
8 0.87
9 0.82
10 0.79
11 0.71
12 0.62
13 0.54
14 0.46
15 0.39
16 0.31
17 0.24
18 0.16
19 0.13
20 0.13
21 0.11
22 0.09
23 0.1
24 0.18
25 0.26
26 0.33
27 0.4
28 0.45
29 0.49
30 0.54
31 0.58
32 0.58
33 0.6
34 0.62
35 0.61
36 0.56
37 0.51
38 0.46
39 0.4
40 0.33
41 0.24
42 0.14
43 0.08
44 0.08
45 0.08
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.05
53 0.07
54 0.06
55 0.07
56 0.1
57 0.11
58 0.14