Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U9J9

Protein Details
Accession A0A397U9J9    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTSDVAKTKKTKKPTKKTNQELIKEPTHydrophilic
48-73NDEQRDKNSKKPRRLKSPPKELTKNLHydrophilic
NLS Segment(s)
PositionSequence
9-14KKTKKP
53-67DKNSKKPRRLKSPPK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MTSDVAKTKKTKKPTKKTNQELIKEPTNNDENLLKPMIELEQRNKDKNDEQRDKNSKKPRRLKSPPKELTKNLLENPPTTTKTQKSIDLLKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.9
3 0.91
4 0.93
5 0.93
6 0.91
7 0.85
8 0.81
9 0.75
10 0.72
11 0.63
12 0.54
13 0.49
14 0.42
15 0.37
16 0.32
17 0.28
18 0.21
19 0.21
20 0.21
21 0.15
22 0.12
23 0.13
24 0.13
25 0.14
26 0.14
27 0.17
28 0.26
29 0.29
30 0.32
31 0.32
32 0.33
33 0.36
34 0.43
35 0.48
36 0.47
37 0.48
38 0.56
39 0.65
40 0.66
41 0.7
42 0.72
43 0.7
44 0.72
45 0.78
46 0.77
47 0.78
48 0.85
49 0.88
50 0.87
51 0.9
52 0.88
53 0.88
54 0.85
55 0.77
56 0.74
57 0.7
58 0.65
59 0.57
60 0.55
61 0.47
62 0.41
63 0.44
64 0.42
65 0.37
66 0.35
67 0.38
68 0.35
69 0.41
70 0.43
71 0.44
72 0.44
73 0.52