Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UYN8

Protein Details
Accession A0A397UYN8    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-38RNKISKGYYFWKKRQHKRFSKQKQQQEKQQLYQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 12.833, nucl 6, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MVFFFRNKISKGYYFWKKRQHKRFSKQKQQQEKQQLYQQWNGIVKSISRRRQDPPEIDQAYIRKGKSQVVECKVSDPKPDEARYGTHPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.68
4 0.73
5 0.79
6 0.85
7 0.86
8 0.87
9 0.89
10 0.92
11 0.93
12 0.93
13 0.92
14 0.92
15 0.92
16 0.89
17 0.88
18 0.88
19 0.82
20 0.75
21 0.72
22 0.67
23 0.59
24 0.55
25 0.47
26 0.4
27 0.36
28 0.31
29 0.26
30 0.21
31 0.17
32 0.22
33 0.29
34 0.32
35 0.33
36 0.37
37 0.4
38 0.49
39 0.55
40 0.52
41 0.49
42 0.52
43 0.5
44 0.48
45 0.46
46 0.38
47 0.36
48 0.35
49 0.3
50 0.24
51 0.24
52 0.27
53 0.31
54 0.38
55 0.42
56 0.44
57 0.49
58 0.45
59 0.49
60 0.51
61 0.47
62 0.45
63 0.4
64 0.42
65 0.45
66 0.47
67 0.45
68 0.42
69 0.44