Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397U616

Protein Details
Accession A0A397U616    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-102KTTTPRMTTPRKEATKKRKLIPIKHydrophilic
NLS Segment(s)
PositionSequence
89-102RKEATKKRKLIPIK
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
Amino Acid Sequences MTTPKMTTSKKEVSQKREKTTTPKTMTPRMTIPRMTILNTKAPRMMTLRTIIPKMITPKMTTSKMTIPRIMTPRMTTPKTTTPRMTTPRKEATKKRKLIPIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.78
4 0.77
5 0.73
6 0.72
7 0.74
8 0.74
9 0.69
10 0.67
11 0.65
12 0.66
13 0.66
14 0.59
15 0.57
16 0.52
17 0.51
18 0.45
19 0.4
20 0.37
21 0.35
22 0.33
23 0.3
24 0.27
25 0.31
26 0.31
27 0.3
28 0.26
29 0.25
30 0.25
31 0.24
32 0.23
33 0.16
34 0.18
35 0.19
36 0.19
37 0.2
38 0.18
39 0.16
40 0.17
41 0.18
42 0.2
43 0.18
44 0.17
45 0.21
46 0.26
47 0.28
48 0.27
49 0.26
50 0.3
51 0.37
52 0.39
53 0.38
54 0.35
55 0.39
56 0.42
57 0.41
58 0.36
59 0.3
60 0.36
61 0.4
62 0.4
63 0.37
64 0.38
65 0.45
66 0.49
67 0.52
68 0.49
69 0.47
70 0.54
71 0.6
72 0.64
73 0.62
74 0.65
75 0.69
76 0.73
77 0.77
78 0.78
79 0.81
80 0.82
81 0.83
82 0.82