Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VZG5

Protein Details
Accession A0A397VZG5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKEKRKKSGTACNLCRHQKKRBasic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MKEKRKKSGTACNLCRHQKKRCEGGKVGEESCKRCSRKGSCSYLTNSSDCKNIAFLDTLGSGISSTYAISILFKIQYKIFAGRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.78
4 0.77
5 0.75
6 0.76
7 0.78
8 0.76
9 0.75
10 0.69
11 0.7
12 0.67
13 0.62
14 0.55
15 0.51
16 0.46
17 0.41
18 0.42
19 0.43
20 0.37
21 0.35
22 0.43
23 0.43
24 0.5
25 0.55
26 0.57
27 0.54
28 0.56
29 0.56
30 0.54
31 0.49
32 0.41
33 0.34
34 0.28
35 0.25
36 0.22
37 0.19
38 0.14
39 0.12
40 0.12
41 0.11
42 0.1
43 0.1
44 0.1
45 0.1
46 0.08
47 0.08
48 0.07
49 0.05
50 0.06
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.06
57 0.07
58 0.08
59 0.11
60 0.13
61 0.15
62 0.16
63 0.19
64 0.22